Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZWX3

Protein Details
Accession A0A2T6ZWX3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
54-76RVPYRTSKVVKPHHHHHHHHPTABasic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MLCLFFLLTFMSVNKVRLRVLYQPSNPITFASITKHLIVIFNPSLPPLKQHGARVPYRTSKVVKPHHHHHHHHPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.21
5 0.25
6 0.28
7 0.34
8 0.39
9 0.38
10 0.43
11 0.45
12 0.44
13 0.4
14 0.33
15 0.27
16 0.19
17 0.18
18 0.15
19 0.15
20 0.15
21 0.15
22 0.15
23 0.14
24 0.13
25 0.13
26 0.14
27 0.12
28 0.11
29 0.11
30 0.11
31 0.13
32 0.12
33 0.15
34 0.14
35 0.19
36 0.21
37 0.25
38 0.31
39 0.36
40 0.4
41 0.42
42 0.43
43 0.46
44 0.46
45 0.47
46 0.45
47 0.45
48 0.51
49 0.57
50 0.62
51 0.63
52 0.7
53 0.75
54 0.81
55 0.82
56 0.83