Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZI23

Protein Details
Accession A0A2T6ZI23   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
141-167FIRHDNFRQHMKNPRKKCKGIKGEWRTBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
Amino Acid Sequences MNSGPINGHPPPTLQDHIHQEAASHTAVVRDTDAFSHYPWAASPSPYNSPPDQSIPDSVAIDSRRPGAREGSPGRDKTSAQRGGPRIEDQGRRPEQNPYFCERGCEKTFFTRKTDLRRHYTNTAIHNSKKKLECKICGARFIRHDNFRQHMKNPRKKCKGIKGEWRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.37
4 0.4
5 0.41
6 0.37
7 0.32
8 0.29
9 0.29
10 0.23
11 0.15
12 0.11
13 0.11
14 0.12
15 0.12
16 0.12
17 0.1
18 0.1
19 0.11
20 0.13
21 0.12
22 0.12
23 0.15
24 0.14
25 0.14
26 0.13
27 0.17
28 0.16
29 0.17
30 0.19
31 0.2
32 0.24
33 0.25
34 0.29
35 0.25
36 0.28
37 0.28
38 0.29
39 0.27
40 0.25
41 0.25
42 0.22
43 0.22
44 0.19
45 0.17
46 0.17
47 0.15
48 0.14
49 0.14
50 0.16
51 0.16
52 0.17
53 0.18
54 0.18
55 0.19
56 0.26
57 0.29
58 0.33
59 0.36
60 0.36
61 0.37
62 0.35
63 0.34
64 0.31
65 0.37
66 0.34
67 0.3
68 0.35
69 0.35
70 0.35
71 0.37
72 0.33
73 0.28
74 0.28
75 0.31
76 0.27
77 0.34
78 0.35
79 0.36
80 0.35
81 0.4
82 0.4
83 0.43
84 0.44
85 0.39
86 0.4
87 0.38
88 0.41
89 0.35
90 0.36
91 0.33
92 0.32
93 0.29
94 0.35
95 0.42
96 0.41
97 0.42
98 0.44
99 0.46
100 0.53
101 0.61
102 0.59
103 0.59
104 0.62
105 0.64
106 0.6
107 0.61
108 0.56
109 0.52
110 0.53
111 0.51
112 0.52
113 0.54
114 0.52
115 0.54
116 0.56
117 0.55
118 0.58
119 0.6
120 0.59
121 0.61
122 0.68
123 0.64
124 0.65
125 0.64
126 0.59
127 0.58
128 0.61
129 0.6
130 0.56
131 0.59
132 0.58
133 0.61
134 0.64
135 0.63
136 0.61
137 0.64
138 0.68
139 0.72
140 0.76
141 0.81
142 0.82
143 0.86
144 0.9
145 0.9
146 0.9
147 0.9