Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T7A434

Protein Details
Accession A0A2T7A434   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
57-77ASKNVSKKAVVRNRARRRTREHydrophilic
NLS Segment(s)
PositionSequence
68-74RNRARRR
145-193GGGGKGEKKKGGGGEGGGGGGQGKGKGKGKGKEQGKGATLGKEGPETKK
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR000100  RNase_P  
IPR020539  RNase_P_CS  
Gene Ontology GO:0004526  F:ribonuclease P activity  
GO:0000049  F:tRNA binding  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF00825  Ribonuclease_P  
PROSITE View protein in PROSITE  
PS00648  RIBONUCLEASE_P  
Amino Acid Sequences MSVFHATKNFILRQSLKPQALVNSRILANPMHPLHAQIYAKFHDPTLKDKLVINFTASKNVSKKAVVRNRARRRTREAVYQALRERGYGKEGEPLAGGGREKGVTGSLSWFPTFESVNAASEELRAEVRVAVDRWLEFRERALAGGGGKGEKKKGGGGEGGGGGGQGKGKGKGKGKEQGKGATLGKEGPETKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.49
4 0.47
5 0.47
6 0.48
7 0.5
8 0.46
9 0.4
10 0.35
11 0.34
12 0.33
13 0.31
14 0.24
15 0.19
16 0.23
17 0.21
18 0.21
19 0.2
20 0.22
21 0.22
22 0.28
23 0.28
24 0.22
25 0.25
26 0.24
27 0.27
28 0.26
29 0.25
30 0.24
31 0.24
32 0.28
33 0.32
34 0.31
35 0.29
36 0.32
37 0.36
38 0.34
39 0.33
40 0.3
41 0.29
42 0.28
43 0.33
44 0.31
45 0.31
46 0.3
47 0.31
48 0.3
49 0.26
50 0.31
51 0.34
52 0.42
53 0.46
54 0.54
55 0.63
56 0.72
57 0.8
58 0.82
59 0.78
60 0.78
61 0.77
62 0.71
63 0.69
64 0.63
65 0.61
66 0.57
67 0.55
68 0.49
69 0.44
70 0.4
71 0.31
72 0.28
73 0.2
74 0.19
75 0.15
76 0.14
77 0.15
78 0.15
79 0.15
80 0.13
81 0.13
82 0.11
83 0.11
84 0.1
85 0.05
86 0.06
87 0.05
88 0.05
89 0.05
90 0.06
91 0.05
92 0.05
93 0.08
94 0.09
95 0.1
96 0.1
97 0.1
98 0.1
99 0.11
100 0.11
101 0.09
102 0.1
103 0.1
104 0.11
105 0.11
106 0.11
107 0.1
108 0.1
109 0.1
110 0.07
111 0.07
112 0.06
113 0.06
114 0.06
115 0.07
116 0.09
117 0.1
118 0.11
119 0.12
120 0.12
121 0.13
122 0.14
123 0.15
124 0.13
125 0.14
126 0.16
127 0.15
128 0.15
129 0.14
130 0.14
131 0.13
132 0.14
133 0.13
134 0.11
135 0.13
136 0.15
137 0.16
138 0.16
139 0.16
140 0.18
141 0.2
142 0.21
143 0.2
144 0.2
145 0.2
146 0.19
147 0.18
148 0.14
149 0.12
150 0.09
151 0.08
152 0.08
153 0.07
154 0.09
155 0.15
156 0.2
157 0.27
158 0.35
159 0.41
160 0.48
161 0.55
162 0.59
163 0.61
164 0.62
165 0.61
166 0.56
167 0.55
168 0.5
169 0.44
170 0.39
171 0.35
172 0.31
173 0.3
174 0.31