Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T7A2A8

Protein Details
Accession A0A2T7A2A8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-49ELKPSKKAPKWRNEERKLRAEVBasic
NLS Segment(s)
PositionSequence
31-47PSKKAPKWRNEERKLRA
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009360  Isy1  
Gene Ontology GO:0000350  P:generation of catalytic spliceosome for second transesterification step  
Pfam View protein in Pfam  
PF06246  Isy1  
Amino Acid Sequences GREIPGSRGNKYFNHAWELPGVKELFDELKPSKKAPKWRNEERKLRAEVRRNMDGKYYGFDRNED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.33
4 0.34
5 0.34
6 0.29
7 0.27
8 0.24
9 0.17
10 0.16
11 0.16
12 0.13
13 0.11
14 0.15
15 0.12
16 0.19
17 0.2
18 0.22
19 0.28
20 0.3
21 0.4
22 0.45
23 0.54
24 0.56
25 0.66
26 0.76
27 0.79
28 0.84
29 0.81
30 0.81
31 0.77
32 0.76
33 0.73
34 0.72
35 0.71
36 0.67
37 0.69
38 0.62
39 0.57
40 0.54
41 0.5
42 0.41
43 0.38
44 0.34
45 0.31