Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZJ36

Protein Details
Accession A0A2T6ZJ36   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-64EKEEKKLYKEEKKKRTCKNLQKENNKTIREBasic
NLS Segment(s)
PositionSequence
31-49RGKEEKEEKKLYKEEKKKR
Subcellular Location(s) mito 14, nucl 13
Family & Domain DBs
Amino Acid Sequences MLFSEKWLFFLWWRAKQGLYAFYLSIFRSGRGKEEKEEKKLYKEEKKKRTCKNLQKENNKTIRETRTSNNKLKFHPHEPNSMEPYKQKLIYPHPAMRENN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.4
4 0.42
5 0.36
6 0.31
7 0.25
8 0.22
9 0.21
10 0.22
11 0.19
12 0.2
13 0.16
14 0.15
15 0.17
16 0.18
17 0.23
18 0.28
19 0.3
20 0.3
21 0.4
22 0.46
23 0.49
24 0.56
25 0.53
26 0.52
27 0.56
28 0.59
29 0.59
30 0.63
31 0.66
32 0.69
33 0.77
34 0.8
35 0.82
36 0.85
37 0.85
38 0.86
39 0.86
40 0.87
41 0.86
42 0.88
43 0.87
44 0.85
45 0.83
46 0.74
47 0.66
48 0.61
49 0.57
50 0.51
51 0.47
52 0.44
53 0.47
54 0.53
55 0.58
56 0.6
57 0.59
58 0.57
59 0.63
60 0.64
61 0.61
62 0.63
63 0.59
64 0.59
65 0.59
66 0.62
67 0.59
68 0.55
69 0.49
70 0.42
71 0.45
72 0.42
73 0.4
74 0.36
75 0.37
76 0.43
77 0.5
78 0.55
79 0.55
80 0.56