Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T7A3K7

Protein Details
Accession A0A2T7A3K7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-32NSVMSPPATKPPRRRGPRGGRGRNNNNNANGHydrophilic
NLS Segment(s)
PositionSequence
11-24KPPRRRGPRGGRGR
Subcellular Location(s) nucl 12, cyto_nucl 10.5, mito 8, cyto 7
Family & Domain DBs
Amino Acid Sequences MNSVMSPPATKPPRRRGPRGGRGRNNNNNANGDQDVANHQTATNRTSNTPRYTPSTAAPPSAPQRQLYVPPPHTPTIPKVKILKPSAAPPTPPTPPAAPAVRATLEIRGRPPPPAPIQTRSSTETTITAVVDGDNDDKDNDKSSLPASPPPLASPKPAPAPPPPPPFETPDHKTLIRDRQAQIAAYLSSWDTFFALASAKGADEAEPNPGKRLPWTLENNSVDGAGWRPWGEYLHTGHRGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.83
4 0.86
5 0.88
6 0.9
7 0.9
8 0.89
9 0.91
10 0.93
11 0.92
12 0.89
13 0.85
14 0.79
15 0.72
16 0.63
17 0.56
18 0.46
19 0.37
20 0.29
21 0.23
22 0.22
23 0.2
24 0.2
25 0.16
26 0.16
27 0.18
28 0.2
29 0.23
30 0.23
31 0.22
32 0.25
33 0.32
34 0.38
35 0.4
36 0.41
37 0.4
38 0.43
39 0.44
40 0.43
41 0.39
42 0.4
43 0.36
44 0.35
45 0.32
46 0.3
47 0.32
48 0.37
49 0.36
50 0.29
51 0.31
52 0.31
53 0.35
54 0.38
55 0.42
56 0.38
57 0.4
58 0.44
59 0.42
60 0.41
61 0.38
62 0.37
63 0.38
64 0.37
65 0.37
66 0.4
67 0.43
68 0.5
69 0.5
70 0.49
71 0.4
72 0.44
73 0.46
74 0.41
75 0.38
76 0.33
77 0.34
78 0.31
79 0.3
80 0.27
81 0.21
82 0.21
83 0.24
84 0.22
85 0.19
86 0.18
87 0.2
88 0.17
89 0.18
90 0.16
91 0.17
92 0.18
93 0.17
94 0.18
95 0.2
96 0.2
97 0.21
98 0.21
99 0.21
100 0.23
101 0.29
102 0.31
103 0.31
104 0.34
105 0.35
106 0.37
107 0.35
108 0.32
109 0.26
110 0.23
111 0.19
112 0.16
113 0.15
114 0.12
115 0.09
116 0.07
117 0.06
118 0.06
119 0.06
120 0.06
121 0.05
122 0.06
123 0.06
124 0.07
125 0.08
126 0.1
127 0.1
128 0.1
129 0.1
130 0.11
131 0.14
132 0.14
133 0.17
134 0.18
135 0.19
136 0.19
137 0.2
138 0.24
139 0.22
140 0.23
141 0.23
142 0.24
143 0.26
144 0.27
145 0.29
146 0.3
147 0.37
148 0.42
149 0.47
150 0.46
151 0.46
152 0.47
153 0.48
154 0.47
155 0.48
156 0.44
157 0.41
158 0.42
159 0.38
160 0.38
161 0.4
162 0.45
163 0.44
164 0.46
165 0.43
166 0.46
167 0.47
168 0.44
169 0.38
170 0.31
171 0.24
172 0.17
173 0.17
174 0.11
175 0.09
176 0.09
177 0.09
178 0.07
179 0.07
180 0.06
181 0.06
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.07
188 0.08
189 0.08
190 0.09
191 0.1
192 0.17
193 0.2
194 0.21
195 0.24
196 0.25
197 0.25
198 0.26
199 0.32
200 0.28
201 0.33
202 0.41
203 0.44
204 0.52
205 0.53
206 0.51
207 0.45
208 0.41
209 0.32
210 0.25
211 0.21
212 0.14
213 0.14
214 0.13
215 0.13
216 0.14
217 0.16
218 0.18
219 0.21
220 0.25
221 0.32