Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZQG8

Protein Details
Accession A0A2T6ZQG8    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-41EGKQALRKLVRKRHRTNKCIDBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, nucl 13, mito 6, cyto 6
Family & Domain DBs
Amino Acid Sequences MQRPLPRSPLSSQQVLFADEEGKQALRKLVRKRHRTNKCIDGEADGQRGSVTIDPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.32
4 0.22
5 0.18
6 0.14
7 0.14
8 0.1
9 0.1
10 0.08
11 0.09
12 0.12
13 0.15
14 0.22
15 0.29
16 0.39
17 0.48
18 0.58
19 0.67
20 0.75
21 0.8
22 0.8
23 0.79
24 0.79
25 0.74
26 0.68
27 0.58
28 0.53
29 0.47
30 0.45
31 0.4
32 0.3
33 0.25
34 0.21
35 0.21
36 0.18