Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZA53

Protein Details
Accession A0A2T6ZA53   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
139-159YSSPNGRSGKRNHNRCNGTRKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSFFRRSPNYPRENNNAFNTTGSSNHNANAQNHNSDAFNTTNYSYGIYFVNYTLNYTLNYTPNETEMARRIPGTLSPPLLAAPPNPDSTLREATVHQHQGWLQVTDGIQSPNMGMQATPPMSHYAFYVFPCKTTYTLHYSSPNGRSGKRNHNRCNGTRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.67
3 0.6
4 0.51
5 0.45
6 0.41
7 0.33
8 0.29
9 0.26
10 0.24
11 0.22
12 0.22
13 0.27
14 0.28
15 0.3
16 0.35
17 0.34
18 0.32
19 0.32
20 0.32
21 0.27
22 0.24
23 0.24
24 0.17
25 0.15
26 0.14
27 0.14
28 0.15
29 0.14
30 0.15
31 0.12
32 0.12
33 0.11
34 0.1
35 0.1
36 0.09
37 0.12
38 0.1
39 0.11
40 0.11
41 0.11
42 0.11
43 0.13
44 0.15
45 0.15
46 0.16
47 0.17
48 0.16
49 0.16
50 0.17
51 0.15
52 0.15
53 0.15
54 0.16
55 0.14
56 0.14
57 0.14
58 0.12
59 0.14
60 0.15
61 0.14
62 0.13
63 0.13
64 0.13
65 0.13
66 0.13
67 0.11
68 0.08
69 0.1
70 0.11
71 0.12
72 0.12
73 0.13
74 0.14
75 0.18
76 0.2
77 0.17
78 0.17
79 0.16
80 0.19
81 0.25
82 0.26
83 0.22
84 0.21
85 0.2
86 0.24
87 0.25
88 0.22
89 0.16
90 0.14
91 0.14
92 0.14
93 0.14
94 0.1
95 0.09
96 0.08
97 0.08
98 0.07
99 0.08
100 0.07
101 0.06
102 0.06
103 0.11
104 0.12
105 0.12
106 0.12
107 0.15
108 0.16
109 0.16
110 0.16
111 0.13
112 0.15
113 0.16
114 0.21
115 0.18
116 0.19
117 0.2
118 0.22
119 0.21
120 0.22
121 0.26
122 0.27
123 0.3
124 0.33
125 0.36
126 0.39
127 0.44
128 0.44
129 0.46
130 0.42
131 0.43
132 0.47
133 0.51
134 0.58
135 0.62
136 0.68
137 0.71
138 0.78
139 0.83