Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZX96

Protein Details
Accession A0A2T6ZX96    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
141-165GCVTGGFWRRRRDPRRRLLGVQALRHydrophilic
NLS Segment(s)
PositionSequence
151-152RR
154-154P
Subcellular Location(s) plas 10, nucl 5, mito 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039175  TIM22  
Gene Ontology GO:0042721  C:TIM22 mitochondrial import inner membrane insertion complex  
GO:0008320  F:protein transmembrane transporter activity  
GO:0045039  P:protein insertion into mitochondrial inner membrane  
Pfam View protein in Pfam  
PF02466  Tim17  
Amino Acid Sequences MSFGGFPLGGKGLGGTSSSSNEPLTPEQQQMQMVKTIQAGMESCPVKTVISGGMGFGLGAVFGLFMASMSYDTPMTGLPGAPALQNLPLKEQLKRGFKDMGQRSYSTGKNFALVGSIFAGTECCIEGFRAKNDMYNGISAGCVTGGFWRRRRDPRRRLLGVQALRRLVLLLTII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.12
5 0.13
6 0.15
7 0.15
8 0.15
9 0.17
10 0.2
11 0.22
12 0.22
13 0.24
14 0.25
15 0.27
16 0.3
17 0.28
18 0.26
19 0.26
20 0.24
21 0.22
22 0.21
23 0.19
24 0.15
25 0.15
26 0.14
27 0.11
28 0.17
29 0.16
30 0.15
31 0.16
32 0.16
33 0.14
34 0.14
35 0.13
36 0.08
37 0.1
38 0.1
39 0.09
40 0.08
41 0.08
42 0.08
43 0.07
44 0.05
45 0.03
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.04
66 0.05
67 0.06
68 0.05
69 0.05
70 0.05
71 0.08
72 0.1
73 0.1
74 0.11
75 0.16
76 0.17
77 0.18
78 0.24
79 0.28
80 0.33
81 0.34
82 0.35
83 0.33
84 0.34
85 0.42
86 0.43
87 0.42
88 0.37
89 0.37
90 0.37
91 0.38
92 0.39
93 0.31
94 0.29
95 0.22
96 0.21
97 0.21
98 0.18
99 0.15
100 0.12
101 0.11
102 0.09
103 0.09
104 0.07
105 0.07
106 0.07
107 0.06
108 0.06
109 0.06
110 0.05
111 0.05
112 0.06
113 0.1
114 0.13
115 0.14
116 0.18
117 0.18
118 0.21
119 0.23
120 0.26
121 0.23
122 0.21
123 0.2
124 0.16
125 0.15
126 0.12
127 0.11
128 0.07
129 0.05
130 0.05
131 0.11
132 0.18
133 0.24
134 0.31
135 0.38
136 0.47
137 0.58
138 0.68
139 0.74
140 0.77
141 0.82
142 0.86
143 0.86
144 0.82
145 0.81
146 0.81
147 0.78
148 0.75
149 0.7
150 0.6
151 0.53
152 0.48
153 0.39
154 0.29