Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZWR2

Protein Details
Accession A0A2T6ZWR2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-55AHPLAKRKGGRWRWSPRRRKRIDKQTRPPRPPLKLBasic
NLS Segment(s)
PositionSequence
25-55AKRKGGRWRWSPRRRKRIDKQTRPPRPPLKL
Subcellular Location(s) mito 8plas 8extr 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MVPTPRSLLILLLLQMTAIAAHPLAKRKGGRWRWSPRRRKRIDKQTRPPRPPLKLENRGSGLGRSPITAPVNILYGPAPLFQLEAALPARRCIIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.06
5 0.04
6 0.04
7 0.04
8 0.08
9 0.1
10 0.16
11 0.18
12 0.23
13 0.25
14 0.29
15 0.4
16 0.46
17 0.52
18 0.57
19 0.66
20 0.72
21 0.81
22 0.87
23 0.87
24 0.9
25 0.89
26 0.9
27 0.9
28 0.9
29 0.91
30 0.91
31 0.91
32 0.91
33 0.93
34 0.86
35 0.85
36 0.81
37 0.74
38 0.69
39 0.68
40 0.67
41 0.66
42 0.65
43 0.61
44 0.56
45 0.53
46 0.48
47 0.39
48 0.31
49 0.24
50 0.21
51 0.17
52 0.15
53 0.18
54 0.19
55 0.18
56 0.17
57 0.14
58 0.16
59 0.14
60 0.14
61 0.1
62 0.09
63 0.1
64 0.09
65 0.09
66 0.08
67 0.08
68 0.07
69 0.08
70 0.07
71 0.1
72 0.11
73 0.16
74 0.16
75 0.17