Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZMY0

Protein Details
Accession A0A2T6ZMY0   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-75LSIIVFIRQRNKRKYRERNSGIPSRIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSWAHNLNKIRANTAPVGEKIYNSVYMKIKMLCSIVHQALHASTSIHTCLSIIVFIRQRNKRKYRERNSGIPSRISNNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.27
4 0.31
5 0.28
6 0.26
7 0.24
8 0.23
9 0.25
10 0.21
11 0.25
12 0.22
13 0.23
14 0.25
15 0.24
16 0.23
17 0.19
18 0.19
19 0.15
20 0.15
21 0.18
22 0.17
23 0.16
24 0.15
25 0.14
26 0.13
27 0.13
28 0.1
29 0.06
30 0.06
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.07
37 0.06
38 0.07
39 0.06
40 0.1
41 0.14
42 0.18
43 0.27
44 0.35
45 0.44
46 0.53
47 0.62
48 0.68
49 0.76
50 0.84
51 0.85
52 0.88
53 0.87
54 0.86
55 0.85
56 0.84
57 0.76
58 0.7
59 0.63