Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZS49

Protein Details
Accession A0A2T6ZS49   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
86-112TGHPCGLYSRSQRRQRKEKGGGGRTISHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, cyto 7.5, cyto_nucl 6, mito 4, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MAGCNCIPNAGITNVVVFRKPDMLSTCVLTLYADANCLSNSNSKIGLITPASHPSACIGPIRDANHQNLMVMCSSGKVQSSNAESTGHPCGLYSRSQRRQRKEKGGGGRTISFLFFRSMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.15
5 0.15
6 0.18
7 0.18
8 0.21
9 0.21
10 0.23
11 0.23
12 0.24
13 0.23
14 0.19
15 0.18
16 0.14
17 0.11
18 0.1
19 0.09
20 0.08
21 0.08
22 0.08
23 0.08
24 0.09
25 0.1
26 0.12
27 0.13
28 0.14
29 0.14
30 0.13
31 0.13
32 0.13
33 0.15
34 0.11
35 0.11
36 0.11
37 0.14
38 0.15
39 0.14
40 0.14
41 0.12
42 0.12
43 0.12
44 0.11
45 0.1
46 0.1
47 0.14
48 0.17
49 0.2
50 0.22
51 0.23
52 0.24
53 0.23
54 0.22
55 0.19
56 0.17
57 0.13
58 0.11
59 0.09
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.12
67 0.15
68 0.16
69 0.17
70 0.18
71 0.17
72 0.19
73 0.22
74 0.19
75 0.15
76 0.14
77 0.15
78 0.15
79 0.22
80 0.28
81 0.35
82 0.45
83 0.55
84 0.64
85 0.72
86 0.81
87 0.85
88 0.87
89 0.86
90 0.85
91 0.86
92 0.84
93 0.8
94 0.75
95 0.67
96 0.58
97 0.49
98 0.42
99 0.32
100 0.26