Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZHK4

Protein Details
Accession A0A2T6ZHK4    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MCFGSIKTLRRRLKKPSVNTAEKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 10.333, nucl 7.5, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MCFGSIKTLRRRLKKPSVNTAEKPTSAWTSTTSRPTSAVIHKPPPSLGLDSPTAAGGMESSPVAEKKPLATAIPSKPTSPTNYLSAPKPSYSSRTKSHTSPSNPYSGGVASSSTYGSKSYDIGSSSGSGGHHGGCGRGGGGGDGGGGGDRGISFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.82
4 0.83
5 0.82
6 0.8
7 0.78
8 0.72
9 0.63
10 0.55
11 0.48
12 0.41
13 0.34
14 0.3
15 0.25
16 0.25
17 0.29
18 0.35
19 0.33
20 0.3
21 0.3
22 0.31
23 0.32
24 0.35
25 0.38
26 0.37
27 0.42
28 0.44
29 0.44
30 0.42
31 0.39
32 0.35
33 0.29
34 0.24
35 0.21
36 0.19
37 0.18
38 0.18
39 0.16
40 0.13
41 0.1
42 0.09
43 0.06
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.06
51 0.07
52 0.07
53 0.07
54 0.1
55 0.1
56 0.1
57 0.12
58 0.17
59 0.19
60 0.25
61 0.25
62 0.23
63 0.24
64 0.25
65 0.27
66 0.25
67 0.24
68 0.21
69 0.24
70 0.25
71 0.26
72 0.28
73 0.26
74 0.23
75 0.23
76 0.21
77 0.24
78 0.28
79 0.31
80 0.31
81 0.35
82 0.38
83 0.38
84 0.44
85 0.47
86 0.46
87 0.49
88 0.47
89 0.46
90 0.43
91 0.41
92 0.34
93 0.26
94 0.21
95 0.14
96 0.12
97 0.08
98 0.08
99 0.09
100 0.08
101 0.08
102 0.08
103 0.09
104 0.09
105 0.1
106 0.11
107 0.12
108 0.13
109 0.13
110 0.14
111 0.14
112 0.13
113 0.14
114 0.12
115 0.12
116 0.11
117 0.11
118 0.12
119 0.11
120 0.11
121 0.1
122 0.11
123 0.09
124 0.09
125 0.09
126 0.07
127 0.07
128 0.06
129 0.06
130 0.05
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04