Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6Z9I0

Protein Details
Accession A0A2T6Z9I0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-45APSTVMHRKKGRKTRKAEEEKRQNMTHydrophilic
NLS Segment(s)
PositionSequence
27-37RKKGRKTRKAE
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MAINRAAPSLTAAAGRVGCAPSTVMHRKKGRKTRKAEEEKRQNMTPEEKDQVLERCYFRCRLGFPPTIWQWKDIAYLIVHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.11
5 0.1
6 0.1
7 0.1
8 0.09
9 0.17
10 0.25
11 0.28
12 0.35
13 0.43
14 0.51
15 0.6
16 0.7
17 0.73
18 0.74
19 0.79
20 0.81
21 0.84
22 0.87
23 0.86
24 0.86
25 0.86
26 0.82
27 0.77
28 0.69
29 0.59
30 0.51
31 0.47
32 0.4
33 0.34
34 0.3
35 0.26
36 0.26
37 0.26
38 0.27
39 0.23
40 0.23
41 0.21
42 0.21
43 0.24
44 0.26
45 0.25
46 0.25
47 0.26
48 0.29
49 0.35
50 0.38
51 0.37
52 0.43
53 0.48
54 0.53
55 0.51
56 0.46
57 0.4
58 0.36
59 0.37
60 0.29
61 0.26