Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZWT5

Protein Details
Accession A0A2T6ZWT5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
94-114IEKVRDERSAKKRTRNEAGDCHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 23, mito 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPLHTAMILTPHSLLILLLLQITTTTTAHPLTKRRGGGGGGGRSGGGGGTLTLSSSSVSWKIVVAIVVSILGAFLLLYIIYQCCAPGHKLHDWIEKVRDERSAKKRTRNEAGDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.07
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.06
10 0.07
11 0.06
12 0.07
13 0.08
14 0.1
15 0.14
16 0.18
17 0.23
18 0.29
19 0.35
20 0.35
21 0.35
22 0.35
23 0.33
24 0.34
25 0.35
26 0.3
27 0.25
28 0.24
29 0.22
30 0.19
31 0.18
32 0.12
33 0.06
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.05
53 0.05
54 0.04
55 0.04
56 0.03
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.05
71 0.07
72 0.09
73 0.13
74 0.18
75 0.22
76 0.28
77 0.33
78 0.41
79 0.42
80 0.45
81 0.46
82 0.46
83 0.44
84 0.4
85 0.43
86 0.4
87 0.46
88 0.52
89 0.57
90 0.59
91 0.68
92 0.75
93 0.77
94 0.82