Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZTE3

Protein Details
Accession A0A2T6ZTE3    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPHGRRRKPKRDPQVPRGLIHBasic
NLS Segment(s)
PositionSequence
4-12GRRRKPKRD
Subcellular Location(s) mito 18, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPHGRRRKPKRDPQVPRGLIHKLPVPYGAHVFFKIFSLQSLTEPQYRTGKGGMRMTNSRHPSHLGKIPRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.85
3 0.76
4 0.7
5 0.63
6 0.53
7 0.45
8 0.4
9 0.29
10 0.26
11 0.27
12 0.24
13 0.2
14 0.22
15 0.21
16 0.17
17 0.16
18 0.16
19 0.13
20 0.13
21 0.12
22 0.09
23 0.08
24 0.09
25 0.09
26 0.1
27 0.13
28 0.15
29 0.18
30 0.19
31 0.21
32 0.24
33 0.24
34 0.24
35 0.24
36 0.26
37 0.29
38 0.35
39 0.35
40 0.36
41 0.41
42 0.45
43 0.51
44 0.51
45 0.48
46 0.43
47 0.45
48 0.44
49 0.46
50 0.48