Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2U9T9

Protein Details
Accession Q2U9T9    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MYRKKRSIPGLRNVSRRRETHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MYRKKRSIPGLRNVSRRRETIFRKCSELSQFGVDVWVVICAGARSSVFRSSESELFGSLDRQIMRASHRPTWKGLRDYDRRLRERRPLRLIDRLEVDVPGIAGDQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.74
3 0.67
4 0.63
5 0.61
6 0.63
7 0.63
8 0.66
9 0.6
10 0.61
11 0.59
12 0.58
13 0.55
14 0.49
15 0.4
16 0.33
17 0.3
18 0.24
19 0.24
20 0.18
21 0.12
22 0.09
23 0.07
24 0.04
25 0.04
26 0.04
27 0.03
28 0.04
29 0.04
30 0.04
31 0.06
32 0.08
33 0.11
34 0.12
35 0.13
36 0.16
37 0.18
38 0.19
39 0.19
40 0.17
41 0.14
42 0.14
43 0.13
44 0.11
45 0.08
46 0.1
47 0.09
48 0.09
49 0.09
50 0.1
51 0.14
52 0.21
53 0.25
54 0.29
55 0.34
56 0.35
57 0.4
58 0.47
59 0.49
60 0.47
61 0.49
62 0.52
63 0.55
64 0.62
65 0.67
66 0.68
67 0.68
68 0.69
69 0.69
70 0.7
71 0.72
72 0.73
73 0.72
74 0.71
75 0.7
76 0.74
77 0.71
78 0.65
79 0.6
80 0.53
81 0.45
82 0.36
83 0.31
84 0.22
85 0.18
86 0.14