Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZK21

Protein Details
Accession A0A2T6ZK21   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-30RYNEKKPSTYKYQKKTPANYPMKHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 7, E.R. 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MTQNVSFRYNEKKPSTYKYQKKTPANYPMKVRDPNHPPHHSLIHIVFRFALVYFIFNLPYIHTSDGQGAPRIIQFTPSWLIVSVWLEVRRHHYRYHTPFYFIFFRFEKCAEPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.66
3 0.67
4 0.71
5 0.71
6 0.75
7 0.79
8 0.82
9 0.82
10 0.8
11 0.81
12 0.79
13 0.75
14 0.73
15 0.71
16 0.68
17 0.69
18 0.61
19 0.59
20 0.58
21 0.62
22 0.64
23 0.6
24 0.55
25 0.51
26 0.52
27 0.44
28 0.4
29 0.33
30 0.32
31 0.28
32 0.25
33 0.22
34 0.19
35 0.18
36 0.15
37 0.13
38 0.05
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.09
48 0.09
49 0.09
50 0.1
51 0.12
52 0.14
53 0.15
54 0.15
55 0.14
56 0.13
57 0.13
58 0.14
59 0.12
60 0.12
61 0.11
62 0.12
63 0.15
64 0.14
65 0.14
66 0.13
67 0.13
68 0.12
69 0.13
70 0.11
71 0.13
72 0.15
73 0.15
74 0.16
75 0.24
76 0.3
77 0.31
78 0.34
79 0.38
80 0.46
81 0.54
82 0.63
83 0.57
84 0.55
85 0.54
86 0.55
87 0.54
88 0.44
89 0.41
90 0.33
91 0.34
92 0.34
93 0.34