Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZH29

Protein Details
Accession A0A2T6ZH29    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-42TTTSTKTANVPKPTRKRQKINSDEAPKPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MPRKSQEKGSKPAETTTSTKTANVPKPTRKRQKINSDEAPKPATPISTFRVNQGVYLNKIHEVWTDTSISTSFDYMEFLKTAIDTVWEYAEPRSLHRESVEAMVHADGKWAKDEAMKVKLDMFRQGKLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.43
4 0.41
5 0.35
6 0.34
7 0.36
8 0.41
9 0.44
10 0.5
11 0.53
12 0.58
13 0.67
14 0.77
15 0.83
16 0.83
17 0.85
18 0.86
19 0.89
20 0.88
21 0.86
22 0.86
23 0.82
24 0.75
25 0.68
26 0.62
27 0.51
28 0.43
29 0.35
30 0.26
31 0.2
32 0.21
33 0.21
34 0.25
35 0.25
36 0.25
37 0.29
38 0.27
39 0.27
40 0.27
41 0.26
42 0.2
43 0.21
44 0.2
45 0.16
46 0.16
47 0.15
48 0.13
49 0.13
50 0.12
51 0.13
52 0.13
53 0.12
54 0.12
55 0.12
56 0.12
57 0.09
58 0.08
59 0.07
60 0.06
61 0.08
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.07
75 0.08
76 0.08
77 0.14
78 0.13
79 0.14
80 0.2
81 0.2
82 0.21
83 0.21
84 0.22
85 0.19
86 0.23
87 0.22
88 0.16
89 0.16
90 0.15
91 0.15
92 0.14
93 0.16
94 0.13
95 0.12
96 0.14
97 0.14
98 0.14
99 0.16
100 0.21
101 0.24
102 0.29
103 0.3
104 0.28
105 0.34
106 0.37
107 0.36
108 0.41
109 0.37
110 0.37