Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UNB5

Protein Details
Accession Q2UNB5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-26INERMPRRKVQQFQAHGQHDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 9, pero 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025799  Arg_MeTrfase  
IPR041698  Methyltransf_25  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0042802  F:identical protein binding  
GO:0035242  F:protein-arginine omega-N asymmetric methyltransferase activity  
GO:0035241  F:protein-arginine omega-N monomethyltransferase activity  
GO:0046656  P:folic acid biosynthetic process  
GO:0006406  P:mRNA export from nucleus  
GO:0060567  P:negative regulation of termination of DNA-templated transcription  
GO:0018216  P:peptidyl-arginine methylation  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF13649  Methyltransf_25  
PROSITE View protein in PROSITE  
PS51678  SAM_MT_PRMT  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MPKAMGINERMPRRKVQQFQAHGQHDPNHTDGRQEGPCFKDDVRTRSYRDSIYQNRHIFKDKVVLDVGCGTGILSMFAAKAGAKHVIGVDMSSIIEKAKQIVACNGLSDKITLLQGKMEEVVLPYPKVDIIISEWMGYFLLYESMLDTVLYARDRYLVPGGKIFPDKATMYLAAIEDGEYKDDKIGFWDNVYGFDYSPMKEIALTEPLVDTVEMKALVTDPCPIITLDLYTVTPADLAFKVPFSLTAKRSDFIHAVIAWFDIEFGACHKPITFSTGPHAKYTHWKQTVFYLRDVLTVEEEEVVSGVLENKPNDKNKRDLDITISYKFETTDNLRYSEGSCFYRMC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.69
4 0.7
5 0.71
6 0.77
7 0.8
8 0.75
9 0.69
10 0.64
11 0.6
12 0.54
13 0.5
14 0.44
15 0.4
16 0.36
17 0.35
18 0.33
19 0.33
20 0.33
21 0.33
22 0.35
23 0.32
24 0.34
25 0.35
26 0.34
27 0.36
28 0.38
29 0.41
30 0.43
31 0.45
32 0.48
33 0.52
34 0.56
35 0.5
36 0.48
37 0.52
38 0.55
39 0.58
40 0.63
41 0.63
42 0.63
43 0.63
44 0.64
45 0.56
46 0.49
47 0.49
48 0.4
49 0.36
50 0.34
51 0.31
52 0.26
53 0.26
54 0.23
55 0.14
56 0.13
57 0.09
58 0.08
59 0.08
60 0.07
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.05
67 0.06
68 0.07
69 0.1
70 0.09
71 0.1
72 0.1
73 0.11
74 0.11
75 0.1
76 0.09
77 0.07
78 0.07
79 0.07
80 0.07
81 0.05
82 0.07
83 0.07
84 0.08
85 0.11
86 0.12
87 0.13
88 0.16
89 0.2
90 0.19
91 0.2
92 0.18
93 0.16
94 0.15
95 0.14
96 0.11
97 0.09
98 0.11
99 0.1
100 0.1
101 0.11
102 0.11
103 0.11
104 0.11
105 0.1
106 0.08
107 0.08
108 0.1
109 0.1
110 0.1
111 0.09
112 0.09
113 0.09
114 0.09
115 0.08
116 0.06
117 0.08
118 0.11
119 0.11
120 0.11
121 0.11
122 0.11
123 0.11
124 0.1
125 0.07
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.05
133 0.04
134 0.04
135 0.04
136 0.06
137 0.06
138 0.06
139 0.06
140 0.08
141 0.08
142 0.09
143 0.13
144 0.14
145 0.14
146 0.17
147 0.17
148 0.18
149 0.19
150 0.18
151 0.14
152 0.15
153 0.14
154 0.13
155 0.13
156 0.11
157 0.1
158 0.11
159 0.1
160 0.07
161 0.07
162 0.06
163 0.06
164 0.06
165 0.07
166 0.06
167 0.06
168 0.07
169 0.07
170 0.07
171 0.08
172 0.11
173 0.1
174 0.1
175 0.13
176 0.12
177 0.13
178 0.15
179 0.13
180 0.1
181 0.12
182 0.13
183 0.1
184 0.12
185 0.1
186 0.09
187 0.09
188 0.1
189 0.09
190 0.11
191 0.1
192 0.09
193 0.09
194 0.09
195 0.09
196 0.08
197 0.07
198 0.05
199 0.06
200 0.06
201 0.05
202 0.05
203 0.06
204 0.07
205 0.07
206 0.08
207 0.08
208 0.08
209 0.09
210 0.09
211 0.09
212 0.08
213 0.08
214 0.07
215 0.08
216 0.08
217 0.07
218 0.07
219 0.06
220 0.06
221 0.05
222 0.07
223 0.06
224 0.08
225 0.09
226 0.09
227 0.09
228 0.09
229 0.12
230 0.14
231 0.2
232 0.2
233 0.27
234 0.29
235 0.3
236 0.31
237 0.32
238 0.29
239 0.24
240 0.26
241 0.18
242 0.17
243 0.16
244 0.15
245 0.11
246 0.1
247 0.09
248 0.05
249 0.05
250 0.05
251 0.07
252 0.09
253 0.09
254 0.1
255 0.11
256 0.13
257 0.13
258 0.21
259 0.2
260 0.18
261 0.26
262 0.33
263 0.34
264 0.34
265 0.35
266 0.29
267 0.38
268 0.45
269 0.48
270 0.47
271 0.47
272 0.45
273 0.54
274 0.62
275 0.55
276 0.48
277 0.43
278 0.37
279 0.38
280 0.38
281 0.29
282 0.21
283 0.19
284 0.17
285 0.13
286 0.13
287 0.11
288 0.09
289 0.08
290 0.06
291 0.06
292 0.08
293 0.09
294 0.13
295 0.15
296 0.2
297 0.27
298 0.36
299 0.44
300 0.47
301 0.54
302 0.56
303 0.63
304 0.62
305 0.57
306 0.55
307 0.56
308 0.55
309 0.49
310 0.45
311 0.37
312 0.34
313 0.32
314 0.26
315 0.23
316 0.25
317 0.3
318 0.32
319 0.34
320 0.34
321 0.34
322 0.36
323 0.35
324 0.34
325 0.28