Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZQK0

Protein Details
Accession A0A2T6ZQK0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-74AGWPQFPPYKRQKKFRTKLCPPVLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 9, extr 6, plas 3
Family & Domain DBs
Amino Acid Sequences MSAFFPSRSLLLVRLFVSFPLAYPQSAGPCSLSGACMPWLVSLAGHRLLAGWPQFPPYKRQKKFRTKLCPPVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.19
5 0.15
6 0.13
7 0.15
8 0.15
9 0.13
10 0.14
11 0.15
12 0.14
13 0.15
14 0.15
15 0.11
16 0.1
17 0.12
18 0.1
19 0.1
20 0.07
21 0.08
22 0.08
23 0.07
24 0.07
25 0.06
26 0.07
27 0.06
28 0.06
29 0.06
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.11
37 0.12
38 0.11
39 0.1
40 0.14
41 0.19
42 0.19
43 0.27
44 0.35
45 0.45
46 0.52
47 0.62
48 0.69
49 0.77
50 0.86
51 0.89
52 0.89
53 0.88
54 0.91