Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZL89

Protein Details
Accession A0A2T6ZL89    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-85LSTAGRRRAASEKKRKKKKRCRGIPTRARRBasic
NLS Segment(s)
PositionSequence
60-85GRRRAASEKKRKKKKRCRGIPTRARR
Subcellular Location(s) plas 11, extr 8, mito 5, E.R. 2
Family & Domain DBs
Amino Acid Sequences MGWMGSFCLVAFAFFLSFLLSPCFVYSNSSADGIQVSLAVFLLIGLYRTGTSTCKLSTAGRRRAASEKKRKKKKRCRGIPTRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.07
5 0.07
6 0.09
7 0.09
8 0.09
9 0.1
10 0.11
11 0.1
12 0.13
13 0.13
14 0.14
15 0.14
16 0.15
17 0.14
18 0.13
19 0.13
20 0.1
21 0.09
22 0.06
23 0.05
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.02
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.05
37 0.06
38 0.08
39 0.09
40 0.1
41 0.1
42 0.12
43 0.16
44 0.25
45 0.34
46 0.42
47 0.46
48 0.47
49 0.5
50 0.58
51 0.64
52 0.65
53 0.67
54 0.7
55 0.74
56 0.84
57 0.91
58 0.94
59 0.95
60 0.95
61 0.95
62 0.95
63 0.95
64 0.95
65 0.96