Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZFK8

Protein Details
Accession A0A2T6ZFK8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-94AWTNSKSRLCEKEKKKRNHGPVDFVSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, golg 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKRSYHRRWALSRYLCLLCMLVSFDCTVWVPVTVRISQFYISKAHTGSVSTHFSLYFKTFSSLVCTERAWTNSKSRLCEKEKKKRNHGPVDFVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.49
3 0.42
4 0.34
5 0.24
6 0.18
7 0.16
8 0.1
9 0.1
10 0.09
11 0.09
12 0.09
13 0.09
14 0.1
15 0.08
16 0.09
17 0.09
18 0.11
19 0.14
20 0.14
21 0.14
22 0.15
23 0.15
24 0.16
25 0.16
26 0.15
27 0.15
28 0.14
29 0.15
30 0.14
31 0.13
32 0.12
33 0.12
34 0.12
35 0.14
36 0.16
37 0.15
38 0.15
39 0.14
40 0.14
41 0.15
42 0.15
43 0.12
44 0.1
45 0.11
46 0.11
47 0.11
48 0.17
49 0.17
50 0.17
51 0.18
52 0.18
53 0.18
54 0.21
55 0.23
56 0.22
57 0.23
58 0.29
59 0.35
60 0.39
61 0.43
62 0.46
63 0.53
64 0.56
65 0.64
66 0.67
67 0.71
68 0.77
69 0.82
70 0.86
71 0.88
72 0.9
73 0.91
74 0.87