Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZWD1

Protein Details
Accession A0A2T6ZWD1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-79VRKPKLPLTSRERNRKEKKRKVEKVKKVGGLGKBasic
NLS Segment(s)
PositionSequence
48-80RKPKLPLTSRERNRKEKKRKVEKVKKVGGLGKR
Subcellular Location(s) mito 8, E.R. 7, plas 3, golg 3, cyto 2, extr 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MRIFLVSFFSFFAIGLGKVIRAGISLRLFFLEPYSLESAFHLLPLSVRKPKLPLTSRERNRKEKKRKVEKVKKVGGLGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.07
7 0.07
8 0.06
9 0.07
10 0.11
11 0.13
12 0.13
13 0.13
14 0.14
15 0.14
16 0.14
17 0.14
18 0.1
19 0.08
20 0.11
21 0.12
22 0.11
23 0.11
24 0.11
25 0.12
26 0.11
27 0.11
28 0.07
29 0.05
30 0.07
31 0.09
32 0.13
33 0.16
34 0.17
35 0.18
36 0.21
37 0.27
38 0.36
39 0.38
40 0.43
41 0.46
42 0.57
43 0.65
44 0.73
45 0.75
46 0.76
47 0.82
48 0.85
49 0.88
50 0.88
51 0.9
52 0.91
53 0.94
54 0.94
55 0.95
56 0.95
57 0.94
58 0.93
59 0.87
60 0.82