Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZQ34

Protein Details
Accession A0A2T6ZQ34   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-80PKFILRKREGKEKEKKKRKEKKKELAPIVPAGBasic
NLS Segment(s)
PositionSequence
52-72ILRKREGKEKEKKKRKEKKKE
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MCVCMCVHAYMYVYMYVCTHLYVYVRSCMLDLLLTTILSKVNYGPSASPKFILRKREGKEKEKKKRKEKKKELAPIVPAGDRTVLYRAVLVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.11
5 0.11
6 0.1
7 0.09
8 0.1
9 0.12
10 0.13
11 0.15
12 0.15
13 0.14
14 0.14
15 0.13
16 0.12
17 0.1
18 0.08
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.07
26 0.08
27 0.06
28 0.07
29 0.08
30 0.09
31 0.09
32 0.14
33 0.17
34 0.17
35 0.18
36 0.18
37 0.25
38 0.28
39 0.35
40 0.35
41 0.4
42 0.44
43 0.54
44 0.59
45 0.62
46 0.69
47 0.73
48 0.78
49 0.8
50 0.87
51 0.87
52 0.91
53 0.92
54 0.93
55 0.94
56 0.93
57 0.94
58 0.94
59 0.92
60 0.88
61 0.81
62 0.73
63 0.65
64 0.55
65 0.45
66 0.35
67 0.28
68 0.21
69 0.19
70 0.17
71 0.15
72 0.14