Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZZ14

Protein Details
Accession A0A2T6ZZ14    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
114-135WAKRSGPQHPDKRERGGCRKKEBasic
NLS Segment(s)
PositionSequence
126-128RER
Subcellular Location(s) cyto 11, cyto_nucl 10.833, nucl 9.5, cyto_mito 8.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR013506  Topo_IIA_bsu_dom2  
Gene Ontology GO:0005524  F:ATP binding  
GO:0003677  F:DNA binding  
GO:0003918  F:DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity  
GO:0006265  P:DNA topological change  
Pfam View protein in Pfam  
PF00204  DNA_gyraseB  
Amino Acid Sequences MNGERIKLNFKKYCEIFINALHEAAGVEEKPVITWEVVNDRWEVAFAASSGNFQQGALKIQNKSGAAVTNAHMRNHFFIFVNCLIENPAFTSQTKEQLTTISKYTGLGQPTANWAKRSGPQHPDKRERGGCRKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.45
4 0.43
5 0.44
6 0.35
7 0.34
8 0.26
9 0.22
10 0.17
11 0.15
12 0.12
13 0.07
14 0.06
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.07
21 0.08
22 0.09
23 0.14
24 0.15
25 0.16
26 0.16
27 0.15
28 0.15
29 0.14
30 0.13
31 0.08
32 0.07
33 0.06
34 0.07
35 0.06
36 0.07
37 0.07
38 0.08
39 0.07
40 0.07
41 0.09
42 0.08
43 0.11
44 0.14
45 0.17
46 0.17
47 0.18
48 0.21
49 0.19
50 0.19
51 0.17
52 0.15
53 0.12
54 0.13
55 0.13
56 0.17
57 0.19
58 0.18
59 0.18
60 0.18
61 0.19
62 0.19
63 0.19
64 0.12
65 0.11
66 0.15
67 0.15
68 0.17
69 0.14
70 0.13
71 0.14
72 0.13
73 0.13
74 0.11
75 0.11
76 0.11
77 0.11
78 0.16
79 0.17
80 0.24
81 0.25
82 0.24
83 0.22
84 0.26
85 0.29
86 0.26
87 0.26
88 0.2
89 0.19
90 0.19
91 0.22
92 0.21
93 0.19
94 0.18
95 0.17
96 0.17
97 0.25
98 0.31
99 0.31
100 0.29
101 0.29
102 0.31
103 0.37
104 0.42
105 0.43
106 0.45
107 0.53
108 0.61
109 0.7
110 0.76
111 0.75
112 0.79
113 0.8
114 0.8
115 0.81