Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZNA7

Protein Details
Accession A0A2T6ZNA7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
212-241NGSRFLEKMKDRRRRSAPRCKYPRNCCLMVHydrophilic
NLS Segment(s)
PositionSequence
224-224R
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MAFWKLNGPGFLERMKERRNTARVLNVFWKLEERRNAGRILATFCELNGPRFLEKVKERRNTARILIVFWKLEERRNAARILATFCELNGPRFLERVKERRNTARILNIFWKLEERRNAGRILATFCELNGPRFLEKMKERRNTARILIVFWKLEERRNAARILATFCELNGPRFLERMKERRNTARILNIFWELEERRNAAHILTTSWKLNGSRFLEKMKDRRRRSAPRCKYPRNCCLMVDMGGDRNWMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.43
4 0.47
5 0.54
6 0.56
7 0.57
8 0.58
9 0.6
10 0.57
11 0.57
12 0.57
13 0.52
14 0.47
15 0.43
16 0.44
17 0.38
18 0.43
19 0.44
20 0.44
21 0.45
22 0.47
23 0.47
24 0.42
25 0.41
26 0.36
27 0.34
28 0.29
29 0.24
30 0.21
31 0.2
32 0.26
33 0.23
34 0.22
35 0.21
36 0.22
37 0.21
38 0.22
39 0.24
40 0.24
41 0.31
42 0.4
43 0.46
44 0.51
45 0.56
46 0.64
47 0.68
48 0.64
49 0.59
50 0.56
51 0.47
52 0.43
53 0.41
54 0.35
55 0.31
56 0.26
57 0.3
58 0.24
59 0.28
60 0.28
61 0.3
62 0.32
63 0.34
64 0.35
65 0.29
66 0.3
67 0.27
68 0.27
69 0.22
70 0.18
71 0.15
72 0.15
73 0.21
74 0.2
75 0.2
76 0.19
77 0.2
78 0.2
79 0.21
80 0.22
81 0.21
82 0.26
83 0.34
84 0.38
85 0.42
86 0.46
87 0.53
88 0.56
89 0.53
90 0.49
91 0.48
92 0.42
93 0.39
94 0.39
95 0.34
96 0.3
97 0.27
98 0.29
99 0.23
100 0.27
101 0.28
102 0.28
103 0.32
104 0.35
105 0.36
106 0.33
107 0.34
108 0.32
109 0.32
110 0.29
111 0.24
112 0.21
113 0.2
114 0.26
115 0.23
116 0.22
117 0.21
118 0.22
119 0.2
120 0.21
121 0.22
122 0.2
123 0.25
124 0.33
125 0.39
126 0.42
127 0.46
128 0.53
129 0.56
130 0.54
131 0.5
132 0.47
133 0.39
134 0.36
135 0.36
136 0.32
137 0.28
138 0.25
139 0.3
140 0.24
141 0.28
142 0.28
143 0.3
144 0.32
145 0.34
146 0.35
147 0.29
148 0.3
149 0.27
150 0.27
151 0.22
152 0.18
153 0.15
154 0.15
155 0.21
156 0.2
157 0.2
158 0.19
159 0.2
160 0.2
161 0.21
162 0.22
163 0.22
164 0.28
165 0.36
166 0.41
167 0.46
168 0.52
169 0.6
170 0.64
171 0.6
172 0.57
173 0.56
174 0.49
175 0.45
176 0.4
177 0.34
178 0.29
179 0.25
180 0.26
181 0.19
182 0.22
183 0.21
184 0.2
185 0.18
186 0.19
187 0.2
188 0.15
189 0.17
190 0.14
191 0.16
192 0.19
193 0.21
194 0.2
195 0.21
196 0.24
197 0.21
198 0.23
199 0.28
200 0.3
201 0.34
202 0.35
203 0.39
204 0.43
205 0.5
206 0.58
207 0.6
208 0.65
209 0.65
210 0.73
211 0.79
212 0.83
213 0.86
214 0.87
215 0.88
216 0.88
217 0.93
218 0.93
219 0.93
220 0.92
221 0.92
222 0.88
223 0.8
224 0.7
225 0.64
226 0.57
227 0.49
228 0.42
229 0.35
230 0.29
231 0.27