Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZPU9

Protein Details
Accession A0A2T6ZPU9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-89FERVKGEREKEKKKKKKKGGDGGEEEBasic
NLS Segment(s)
PositionSequence
68-82KGEREKEKKKKKKKG
Subcellular Location(s) plas 7, mito 5, extr 5, E.R. 5, cyto 2, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
Amino Acid Sequences MAVLFFVGYAIAVLSACGYLTYGYIERAEWLGSRSGLAATLGGDRKMEVVGALWGEEVIGVVVFERVKGEREKEKKKKKKKGGDGGEEEEEEGVIYGWAVRLRYRGKGVGRGLLEKVAEICEGRVRFAEDHVRMFTPPTPVLFFFFVSDGIVSELRDIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.08
9 0.08
10 0.1
11 0.1
12 0.1
13 0.11
14 0.12
15 0.12
16 0.1
17 0.11
18 0.12
19 0.11
20 0.12
21 0.11
22 0.1
23 0.1
24 0.09
25 0.08
26 0.06
27 0.11
28 0.11
29 0.11
30 0.11
31 0.11
32 0.11
33 0.11
34 0.1
35 0.06
36 0.05
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.03
46 0.02
47 0.02
48 0.02
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.08
55 0.1
56 0.14
57 0.22
58 0.31
59 0.42
60 0.52
61 0.62
62 0.71
63 0.8
64 0.87
65 0.88
66 0.9
67 0.9
68 0.9
69 0.88
70 0.86
71 0.8
72 0.73
73 0.64
74 0.53
75 0.42
76 0.31
77 0.22
78 0.13
79 0.08
80 0.04
81 0.03
82 0.03
83 0.03
84 0.04
85 0.05
86 0.05
87 0.06
88 0.11
89 0.14
90 0.17
91 0.2
92 0.25
93 0.26
94 0.34
95 0.35
96 0.35
97 0.35
98 0.34
99 0.32
100 0.28
101 0.25
102 0.18
103 0.17
104 0.12
105 0.11
106 0.09
107 0.09
108 0.13
109 0.14
110 0.14
111 0.15
112 0.17
113 0.17
114 0.2
115 0.29
116 0.25
117 0.28
118 0.3
119 0.3
120 0.27
121 0.29
122 0.28
123 0.24
124 0.23
125 0.23
126 0.24
127 0.24
128 0.27
129 0.26
130 0.24
131 0.2
132 0.19
133 0.17
134 0.15
135 0.14
136 0.11
137 0.12
138 0.11
139 0.1