Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZE09

Protein Details
Accession A0A2T6ZE09    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-59RGSGRRARVRIGKRRRRRVNFMFTGBasic
NLS Segment(s)
PositionSequence
36-52GSGRRARVRIGKRRRRR
Subcellular Location(s) mito 19.5, cyto_mito 11.5, nucl 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MIWKIWSWMLALVVSNEMPGRRFKVTCSVTPVLERGSGRRARVRIGKRRRRRVNFMFTGGGCWGYARKAVVEGERRGDIWFFNIPSASRQTSDGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.1
5 0.11
6 0.13
7 0.16
8 0.19
9 0.19
10 0.2
11 0.29
12 0.33
13 0.34
14 0.4
15 0.38
16 0.35
17 0.35
18 0.35
19 0.26
20 0.25
21 0.22
22 0.16
23 0.22
24 0.24
25 0.25
26 0.29
27 0.29
28 0.3
29 0.39
30 0.46
31 0.49
32 0.57
33 0.66
34 0.7
35 0.81
36 0.86
37 0.85
38 0.86
39 0.84
40 0.83
41 0.77
42 0.7
43 0.62
44 0.51
45 0.46
46 0.36
47 0.28
48 0.17
49 0.13
50 0.1
51 0.08
52 0.09
53 0.08
54 0.08
55 0.1
56 0.12
57 0.18
58 0.24
59 0.26
60 0.28
61 0.29
62 0.29
63 0.28
64 0.27
65 0.21
66 0.17
67 0.19
68 0.16
69 0.17
70 0.18
71 0.18
72 0.2
73 0.26
74 0.25
75 0.22