Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZX67

Protein Details
Accession A0A2T6ZX67    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
172-191TTPEGQHLKPKTKPKSTKRAHydrophilic
NLS Segment(s)
PositionSequence
180-191KPKTKPKSTKRA
Subcellular Location(s) plas 15, mito 6, extr 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009582  Spc2/SPCS2  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06703  SPC25  
Amino Acid Sequences MAARPKANLYALSGLKNTSDDSIAPYLKSKGWKQNHTLTDVRLVLGFSAVTIAGSTFYYDYTLGFDKTKVMTLYAVIAYFVINTVLTWWIWGMEGGKVYVGSKDGVTITISSHTEKHSPIYHLKIVSQSLKQKPTTTEAESPFTSWFDTQGFLVEKPFMTFISNSIPSMAATTPEGQHLKPKTKPKSTKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.24
4 0.21
5 0.15
6 0.14
7 0.12
8 0.16
9 0.2
10 0.2
11 0.2
12 0.21
13 0.22
14 0.24
15 0.3
16 0.32
17 0.38
18 0.46
19 0.52
20 0.56
21 0.64
22 0.64
23 0.63
24 0.59
25 0.5
26 0.48
27 0.41
28 0.35
29 0.26
30 0.23
31 0.17
32 0.14
33 0.12
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.07
47 0.07
48 0.09
49 0.1
50 0.1
51 0.11
52 0.11
53 0.12
54 0.13
55 0.15
56 0.13
57 0.12
58 0.11
59 0.11
60 0.12
61 0.11
62 0.1
63 0.07
64 0.07
65 0.06
66 0.06
67 0.05
68 0.04
69 0.03
70 0.03
71 0.04
72 0.05
73 0.04
74 0.05
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.06
89 0.05
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07
95 0.06
96 0.08
97 0.09
98 0.1
99 0.11
100 0.12
101 0.13
102 0.14
103 0.16
104 0.18
105 0.2
106 0.23
107 0.27
108 0.29
109 0.27
110 0.28
111 0.27
112 0.27
113 0.27
114 0.28
115 0.31
116 0.34
117 0.39
118 0.39
119 0.4
120 0.39
121 0.41
122 0.42
123 0.39
124 0.39
125 0.37
126 0.39
127 0.37
128 0.36
129 0.31
130 0.27
131 0.23
132 0.16
133 0.15
134 0.11
135 0.12
136 0.11
137 0.14
138 0.15
139 0.14
140 0.15
141 0.15
142 0.14
143 0.15
144 0.15
145 0.12
146 0.12
147 0.12
148 0.13
149 0.19
150 0.2
151 0.19
152 0.19
153 0.19
154 0.17
155 0.19
156 0.18
157 0.12
158 0.12
159 0.14
160 0.14
161 0.2
162 0.22
163 0.2
164 0.28
165 0.34
166 0.4
167 0.46
168 0.55
169 0.59
170 0.68
171 0.79