Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZIL5

Protein Details
Accession A0A2T6ZIL5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-126PPSSRPPSRSHTQKRLRAKRAAEHydrophilic
NLS Segment(s)
PositionSequence
115-124TQKRLRAKRA
Subcellular Location(s) mito 14, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
Amino Acid Sequences MGLQYDSPLLVSSPPRITQPILQHPVPHRTLARNFTAFANKSTTNTLLPLVPCPESLFLQTPALPMSYQPPQPPPPQPSPSPSLFAAALSKKRSPQAAFADDTPPSSRPPSRSHTQKRLRAKRAAERPGWVSSKDDSIGLDARVEAVVVDMLWPGVESLDCGRRVGDLRRSGGFTVLCFLGCTIEHLHGLGQVASLLGNLNADVFGVSLSAPPPYTSSLPIIHDRTRALTLSLGLLHPLGGGRQALDAIVILDRDSRQRVVLPVGWGPRPVPGQCASDEESNSINSIVGRCVKGVEWLCNEALDDTVEDAEMGMMDNEIVMAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.29
4 0.31
5 0.34
6 0.41
7 0.46
8 0.48
9 0.48
10 0.52
11 0.55
12 0.6
13 0.55
14 0.51
15 0.44
16 0.45
17 0.51
18 0.5
19 0.52
20 0.45
21 0.45
22 0.44
23 0.49
24 0.43
25 0.38
26 0.38
27 0.32
28 0.32
29 0.34
30 0.32
31 0.25
32 0.24
33 0.23
34 0.21
35 0.21
36 0.22
37 0.21
38 0.2
39 0.19
40 0.2
41 0.2
42 0.18
43 0.2
44 0.2
45 0.19
46 0.2
47 0.2
48 0.19
49 0.18
50 0.18
51 0.14
52 0.12
53 0.14
54 0.17
55 0.2
56 0.22
57 0.28
58 0.32
59 0.38
60 0.45
61 0.47
62 0.5
63 0.52
64 0.52
65 0.51
66 0.52
67 0.48
68 0.44
69 0.38
70 0.32
71 0.26
72 0.24
73 0.24
74 0.23
75 0.25
76 0.26
77 0.28
78 0.29
79 0.31
80 0.36
81 0.33
82 0.36
83 0.39
84 0.39
85 0.39
86 0.38
87 0.38
88 0.32
89 0.32
90 0.27
91 0.2
92 0.17
93 0.2
94 0.21
95 0.23
96 0.28
97 0.33
98 0.4
99 0.5
100 0.57
101 0.64
102 0.7
103 0.75
104 0.8
105 0.84
106 0.83
107 0.8
108 0.78
109 0.76
110 0.76
111 0.75
112 0.66
113 0.59
114 0.54
115 0.52
116 0.47
117 0.38
118 0.31
119 0.24
120 0.24
121 0.21
122 0.18
123 0.12
124 0.12
125 0.13
126 0.11
127 0.1
128 0.08
129 0.08
130 0.07
131 0.07
132 0.05
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.02
142 0.03
143 0.03
144 0.03
145 0.05
146 0.09
147 0.09
148 0.09
149 0.1
150 0.11
151 0.13
152 0.17
153 0.22
154 0.23
155 0.25
156 0.26
157 0.27
158 0.26
159 0.26
160 0.22
161 0.15
162 0.13
163 0.11
164 0.1
165 0.08
166 0.08
167 0.06
168 0.06
169 0.08
170 0.07
171 0.08
172 0.08
173 0.08
174 0.09
175 0.09
176 0.09
177 0.07
178 0.06
179 0.05
180 0.05
181 0.05
182 0.05
183 0.04
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.04
196 0.04
197 0.05
198 0.05
199 0.06
200 0.07
201 0.1
202 0.11
203 0.12
204 0.15
205 0.17
206 0.19
207 0.24
208 0.27
209 0.26
210 0.27
211 0.26
212 0.26
213 0.26
214 0.23
215 0.19
216 0.16
217 0.14
218 0.13
219 0.14
220 0.11
221 0.09
222 0.09
223 0.08
224 0.07
225 0.06
226 0.05
227 0.06
228 0.06
229 0.06
230 0.06
231 0.06
232 0.06
233 0.06
234 0.06
235 0.05
236 0.06
237 0.05
238 0.05
239 0.07
240 0.08
241 0.11
242 0.14
243 0.14
244 0.15
245 0.17
246 0.19
247 0.22
248 0.25
249 0.25
250 0.27
251 0.3
252 0.3
253 0.28
254 0.27
255 0.26
256 0.27
257 0.24
258 0.24
259 0.24
260 0.25
261 0.25
262 0.3
263 0.29
264 0.29
265 0.29
266 0.27
267 0.24
268 0.22
269 0.22
270 0.17
271 0.14
272 0.12
273 0.12
274 0.14
275 0.17
276 0.17
277 0.17
278 0.18
279 0.18
280 0.25
281 0.27
282 0.3
283 0.3
284 0.32
285 0.32
286 0.31
287 0.31
288 0.23
289 0.21
290 0.15
291 0.12
292 0.1
293 0.09
294 0.09
295 0.08
296 0.08
297 0.07
298 0.06
299 0.06
300 0.05
301 0.05
302 0.04
303 0.04
304 0.04