Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZIZ2

Protein Details
Accession A0A2T6ZIZ2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-31GVPGRSKGCNTCRKRKIRCDQKRPECGNCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MVGVPGRSKGCNTCRKRKIRCDQKRPECGNCIKSNRACAGYHRAVVFRNAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.74
3 0.81
4 0.84
5 0.86
6 0.87
7 0.9
8 0.9
9 0.92
10 0.91
11 0.92
12 0.86
13 0.79
14 0.75
15 0.7
16 0.65
17 0.61
18 0.56
19 0.53
20 0.5
21 0.51
22 0.48
23 0.45
24 0.39
25 0.36
26 0.41
27 0.38
28 0.39
29 0.36
30 0.34
31 0.33