Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZV94

Protein Details
Accession A0A2T6ZV94   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MCFARKKERKKEKKSLSLRMIVIHydrophilic
NLS Segment(s)
PositionSequence
5-14RKKERKKEKK
Subcellular Location(s) plas 19, E.R. 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCFARKKERKKEKKSLSLRMIVIVIGNLISNGLFFLCSFSWLVSWLAGYSIVVGFWAGGWVVGLVGRLTTVNYLMFPPSAGVCCCLLSLSVWWLGLTYNSLDFSLIRSERAAVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.88
4 0.84
5 0.74
6 0.65
7 0.54
8 0.43
9 0.33
10 0.23
11 0.15
12 0.08
13 0.07
14 0.04
15 0.04
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.06
23 0.06
24 0.07
25 0.08
26 0.08
27 0.08
28 0.09
29 0.1
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.05
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.07
62 0.07
63 0.06
64 0.07
65 0.07
66 0.08
67 0.08
68 0.09
69 0.09
70 0.1
71 0.1
72 0.09
73 0.09
74 0.08
75 0.09
76 0.09
77 0.1
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.1
84 0.09
85 0.09
86 0.1
87 0.1
88 0.1
89 0.1
90 0.12
91 0.18
92 0.18
93 0.17
94 0.17
95 0.19