Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K1QTC2

Protein Details
Accession A0A2K1QTC2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 15, nucl 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKANHAVVLDKATSDKLQKDVQSYRLVTVAVLVDRLKINGSLARKAIADMEEKGQIKKVVGHSRGSIYTRAVGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.88
9 0.85
10 0.83
11 0.74
12 0.66
13 0.55
14 0.49
15 0.39
16 0.34
17 0.27
18 0.17
19 0.15
20 0.13
21 0.14
22 0.13
23 0.14
24 0.15
25 0.18
26 0.19
27 0.24
28 0.26
29 0.28
30 0.31
31 0.3
32 0.27
33 0.24
34 0.23
35 0.17
36 0.15
37 0.12
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.13
49 0.14
50 0.15
51 0.16
52 0.15
53 0.16
54 0.16
55 0.14
56 0.14
57 0.13
58 0.15
59 0.2
60 0.21
61 0.21
62 0.22
63 0.22
64 0.21
65 0.25
66 0.31
67 0.35
68 0.37
69 0.4
70 0.4
71 0.43
72 0.46
73 0.43
74 0.37
75 0.29
76 0.29
77 0.26