Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UI60

Protein Details
Accession Q2UI60   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-96EISNPPKKPKRDRGHNSTNKNTHydrophilic
NLS Segment(s)
PositionSequence
82-84KPK
Subcellular Location(s) cyto 12.5, cyto_nucl 9.5, mito 8, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MWVKIDRKGLCFTIRVKRNVIPTFVDNKAFVCNPKPVVGKAFGSIETVKIPGAVLVRDCGVHNPNPLVRDSPVNEISNPPKKPKRDRGHNSTNKNTPDDDSYPLYEEPYRLDNHYPCPPVVLTVWSPTLRAPATTFLGISLILEHLEDWGSCGSGDKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.5
4 0.5
5 0.56
6 0.56
7 0.53
8 0.47
9 0.44
10 0.46
11 0.44
12 0.42
13 0.33
14 0.3
15 0.3
16 0.27
17 0.25
18 0.22
19 0.24
20 0.24
21 0.29
22 0.31
23 0.28
24 0.3
25 0.31
26 0.29
27 0.26
28 0.25
29 0.2
30 0.2
31 0.19
32 0.16
33 0.14
34 0.13
35 0.11
36 0.09
37 0.09
38 0.08
39 0.08
40 0.08
41 0.07
42 0.08
43 0.08
44 0.09
45 0.09
46 0.1
47 0.12
48 0.13
49 0.15
50 0.16
51 0.17
52 0.18
53 0.18
54 0.17
55 0.16
56 0.17
57 0.18
58 0.2
59 0.22
60 0.22
61 0.22
62 0.23
63 0.28
64 0.32
65 0.32
66 0.34
67 0.36
68 0.43
69 0.52
70 0.6
71 0.64
72 0.67
73 0.74
74 0.77
75 0.82
76 0.84
77 0.82
78 0.78
79 0.75
80 0.66
81 0.59
82 0.51
83 0.41
84 0.37
85 0.32
86 0.29
87 0.24
88 0.23
89 0.23
90 0.22
91 0.22
92 0.18
93 0.16
94 0.14
95 0.15
96 0.16
97 0.15
98 0.2
99 0.21
100 0.25
101 0.32
102 0.32
103 0.29
104 0.29
105 0.27
106 0.24
107 0.23
108 0.22
109 0.16
110 0.17
111 0.21
112 0.19
113 0.19
114 0.18
115 0.21
116 0.18
117 0.18
118 0.17
119 0.17
120 0.2
121 0.21
122 0.2
123 0.16
124 0.16
125 0.15
126 0.13
127 0.1
128 0.07
129 0.06
130 0.06
131 0.06
132 0.06
133 0.07
134 0.07
135 0.08
136 0.08
137 0.08
138 0.08