FuNGI

A0A2K1QKY9

Protein Details

Accession

A0A2K1QKY9

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
88-108	AKARRLDSSARRKSNRRLMEQ	Hydrophilic
145-175	TPAPDTPSKTPRPRGRPKGRRKERTPTPDFD	Basic
493-530	EMAMGKRPRGRWKKAPVRTSRKKTKTNTKTKAARRAGE	Hydrophilic

NLS Segment(s)

Position	Sequence
153-168	KTPRPRGRPKGRRKER
497-528	GKRPRGRWKKAPVRTSRKKTKTNTKTKAARRA

Subcellular Location(s)

nucl 17.5, cyto_nucl 10.5, mito 7

Family & Domain DBs

InterPro	View protein in InterPro IPR007220 ORC2
Gene Ontology	GO:0005664 C:nuclear origin of replication recognition complex GO:0003688 F:DNA replication origin binding GO:0006260 P:DNA replication
Pfam	View protein in Pfam PF04084 ORC2

Amino Acid Sequences

MARKRVADTAADGEQTPKKRKSVVEAIQESEPAVTSPSQTPSKLRSILKTADDINGEATPKSVRKVLFSQPGTPQEQDDPTSHESPLAKARRLDSSARRKSNRRLMEQGNEDGEDHVEDDEALAEEILAAEEAEDDPPQLEEDITPAPDTPSKTPRPRGRPKGRRKERTPTPDFDMPPHELYFFQNRAGGAKTSTNTLPSSALLNHETYFTKMAGWTDPHASAMSSLDQHHHRAFSQWTFELSESFSLCLHGYGSKRHLLTSFAAHVHATTSPAPHIMIINGYNPSLTPRSILTLLSTLAPSLSLPSNPQTAISALVSHLLTDPPKSPSYLLINSLDARPIRKHLPLLGPLASVLRIVATVDTPTFPLLFPLPLLSQFRFLFHDATTFRPFEAEVEVVDEVNVLLGKSGRRVGGKDGVVFVLKSLPENARGLFRILVGEQLGLMEEAGVLSLGDGDGEEEGGQGMFGAEDRGDWDEDEDEEDDVDEDRDEDAEMAMGKRPRGRWKKAPVRTSRKKTKTNTKTKAARRAGEERVEGVEYRMLYHKAVEEFVCSSEMGFRTLLKEFYDHRIVESRRDASGTERLVVPFGRGELEGLLEELI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.33
2	0.38
3	0.42
4	0.42
5	0.44
6	0.49
7	0.52
8	0.57
9	0.61
10	0.62
11	0.64
12	0.63
13	0.63
14	0.58
15	0.54
16	0.45
17	0.34
18	0.26
19	0.15
20	0.13
21	0.1
22	0.12
23	0.15
24	0.21
25	0.25
26	0.26
27	0.31
28	0.34
29	0.41
30	0.46
31	0.46
32	0.46
33	0.49
34	0.53
35	0.52
36	0.51
37	0.45
38	0.42
39	0.39
40	0.33
41	0.29
42	0.25
43	0.23
44	0.18
45	0.17
46	0.18
47	0.18
48	0.2
49	0.22
50	0.21
51	0.26
52	0.32
53	0.4
54	0.45
55	0.46
56	0.49
57	0.52
58	0.57
59	0.56
60	0.51
61	0.44
62	0.39
63	0.39
64	0.36
65	0.31
66	0.3
67	0.32
68	0.32
69	0.3
70	0.29
71	0.27
72	0.28
73	0.36
74	0.36
75	0.34
76	0.36
77	0.39
78	0.42
79	0.45
80	0.5
81	0.5
82	0.55
83	0.62
84	0.68
85	0.73
86	0.74
87	0.8
88	0.82
89	0.81
90	0.77
91	0.76
92	0.73
93	0.75
94	0.72
95	0.66
96	0.58
97	0.49
98	0.42
99	0.34
100	0.27
101	0.19
102	0.14
103	0.1
104	0.08
105	0.07
106	0.06
107	0.06
108	0.06
109	0.06
110	0.05
111	0.04
112	0.04
113	0.05
114	0.04
115	0.04
116	0.03
117	0.03
118	0.04
119	0.04
120	0.05
121	0.05
122	0.05
123	0.06
124	0.06
125	0.07
126	0.07
127	0.06
128	0.06
129	0.08
130	0.1
131	0.1
132	0.1
133	0.1
134	0.11
135	0.14
136	0.17
137	0.2
138	0.27
139	0.35
140	0.42
141	0.52
142	0.6
143	0.67
144	0.75
145	0.81
146	0.85
147	0.87
148	0.91
149	0.93
150	0.94
151	0.94
152	0.91
153	0.9
154	0.89
155	0.89
156	0.84
157	0.78
158	0.74
159	0.7
160	0.63
161	0.56
162	0.5
163	0.43
164	0.39
165	0.34
166	0.27
167	0.21
168	0.23
169	0.27
170	0.24
171	0.21
172	0.2
173	0.2
174	0.21
175	0.22
176	0.2
177	0.15
178	0.17
179	0.17
180	0.18
181	0.18
182	0.19
183	0.17
184	0.17
185	0.16
186	0.13
187	0.15
188	0.12
189	0.15
190	0.14
191	0.15
192	0.14
193	0.15
194	0.15
195	0.14
196	0.15
197	0.13
198	0.11
199	0.11
200	0.12
201	0.12
202	0.13
203	0.14
204	0.15
205	0.15
206	0.15
207	0.14
208	0.13
209	0.11
210	0.11
211	0.1
212	0.09
213	0.09
214	0.12
215	0.14
216	0.17
217	0.18
218	0.18
219	0.17
220	0.19
221	0.22
222	0.2
223	0.22
224	0.2
225	0.2
226	0.2
227	0.2
228	0.18
229	0.15
230	0.14
231	0.11
232	0.11
233	0.09
234	0.09
235	0.09
236	0.08
237	0.08
238	0.1
239	0.11
240	0.13
241	0.16
242	0.19
243	0.2
244	0.2
245	0.2
246	0.19
247	0.19
248	0.19
249	0.19
250	0.16
251	0.16
252	0.15
253	0.14
254	0.13
255	0.12
256	0.1
257	0.08
258	0.08
259	0.08
260	0.09
261	0.09
262	0.08
263	0.08
264	0.06
265	0.07
266	0.07
267	0.08
268	0.08
269	0.08
270	0.08
271	0.07
272	0.1
273	0.1
274	0.09
275	0.08
276	0.08
277	0.11
278	0.11
279	0.11
280	0.1
281	0.1
282	0.1
283	0.09
284	0.09
285	0.07
286	0.06
287	0.06
288	0.05
289	0.05
290	0.06
291	0.05
292	0.07
293	0.08
294	0.1
295	0.1
296	0.1
297	0.09
298	0.09
299	0.1
300	0.09
301	0.08
302	0.07
303	0.08
304	0.08
305	0.07
306	0.07
307	0.07
308	0.07
309	0.08
310	0.1
311	0.11
312	0.12
313	0.13
314	0.13
315	0.15
316	0.2
317	0.2
318	0.21
319	0.19
320	0.2
321	0.2
322	0.2
323	0.19
324	0.15
325	0.15
326	0.14
327	0.16
328	0.18
329	0.19
330	0.2
331	0.22
332	0.26
333	0.27
334	0.29
335	0.27
336	0.23
337	0.21
338	0.21
339	0.16
340	0.11
341	0.07
342	0.05
343	0.04
344	0.04
345	0.04
346	0.04
347	0.05
348	0.05
349	0.06
350	0.06
351	0.06
352	0.07
353	0.06
354	0.07
355	0.07
356	0.07
357	0.07
358	0.08
359	0.08
360	0.1
361	0.14
362	0.13
363	0.17
364	0.17
365	0.18
366	0.19
367	0.2
368	0.19
369	0.16
370	0.21
371	0.18
372	0.22
373	0.24
374	0.22
375	0.2
376	0.19
377	0.19
378	0.15
379	0.16
380	0.12
381	0.08
382	0.1
383	0.1
384	0.1
385	0.1
386	0.09
387	0.06
388	0.06
389	0.06
390	0.03
391	0.04
392	0.05
393	0.06
394	0.08
395	0.1
396	0.12
397	0.14
398	0.16
399	0.2
400	0.26
401	0.27
402	0.26
403	0.25
404	0.23
405	0.23
406	0.21
407	0.17
408	0.12
409	0.11
410	0.1
411	0.12
412	0.13
413	0.15
414	0.16
415	0.17
416	0.17
417	0.18
418	0.19
419	0.17
420	0.16
421	0.14
422	0.13
423	0.14
424	0.11
425	0.1
426	0.08
427	0.07
428	0.07
429	0.06
430	0.05
431	0.04
432	0.03
433	0.03
434	0.03
435	0.03
436	0.02
437	0.02
438	0.03
439	0.02
440	0.02
441	0.03
442	0.03
443	0.03
444	0.03
445	0.03
446	0.03
447	0.04
448	0.04
449	0.04
450	0.03
451	0.03
452	0.03
453	0.03
454	0.04
455	0.04
456	0.04
457	0.06
458	0.08
459	0.08
460	0.08
461	0.1
462	0.1
463	0.11
464	0.13
465	0.12
466	0.1
467	0.1
468	0.1
469	0.09
470	0.09
471	0.09
472	0.06
473	0.06
474	0.06
475	0.07
476	0.07
477	0.07
478	0.06
479	0.07
480	0.08
481	0.08
482	0.12
483	0.15
484	0.17
485	0.22
486	0.27
487	0.38
488	0.47
489	0.55
490	0.6
491	0.7
492	0.78
493	0.82
494	0.87
495	0.87
496	0.88
497	0.9
498	0.91
499	0.91
500	0.89
501	0.9
502	0.89
503	0.9
504	0.9
505	0.9
506	0.88
507	0.87
508	0.88
509	0.88
510	0.89
511	0.85
512	0.8
513	0.76
514	0.75
515	0.71
516	0.68
517	0.6
518	0.51
519	0.45
520	0.41
521	0.34
522	0.28
523	0.24
524	0.18
525	0.18
526	0.21
527	0.2
528	0.18
529	0.2
530	0.23
531	0.22
532	0.24
533	0.22
534	0.21
535	0.21
536	0.22
537	0.21
538	0.16
539	0.15
540	0.17
541	0.18
542	0.17
543	0.16
544	0.16
545	0.18
546	0.2
547	0.22
548	0.18
549	0.21
550	0.22
551	0.29
552	0.35
553	0.32
554	0.33
555	0.41
556	0.41
557	0.45
558	0.5
559	0.45
560	0.4
561	0.41
562	0.38
563	0.34
564	0.4
565	0.35
566	0.29
567	0.29
568	0.28
569	0.29
570	0.29
571	0.25
572	0.19
573	0.18
574	0.17
575	0.15
576	0.15
577	0.13
578	0.14
579	0.13

A0A2K1QKY9

3D AlphaFold-predicted Structure Viewer