Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K1QIL9

Protein Details
Accession A0A2K1QIL9    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MAHSRSRSPDRPKKSKGGFKWKEKSRKEDTDSBasic
57-89DPDQDRPRSERKSRSRSRERRRRSDRDQAYREDBasic
NLS Segment(s)
PositionSequence
6-28SRSPDRPKKSKGGFKWKEKSRKE
41-80RSPKYDSRDRARERSRDPDQDRPRSERKSRSRSRERRRRS
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
Amino Acid Sequences MAHSRSRSPDRPKKSKGGFKWKEKSRKEDTDSSARNTYRERSPKYDSRDRARERSRDPDQDRPRSERKSRSRSRERRRRSDRDQAYREDRYHDRESGRPRNTTDDTSNRAAADTPDSAPASAPDKTSVAAKFGAKALKSRPAAPTNGSATTTTTTTTTTPSVPSSNQSVSKPKSAKPPSSSEPMIIVYVNDRLGTKAAIPCLASDPVKAFKAMVAARIGRQTHEIMLKRQGERPFKDVLTLEDYGVSNGVQLDLELDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.86
4 0.87
5 0.86
6 0.87
7 0.9
8 0.89
9 0.9
10 0.87
11 0.85
12 0.83
13 0.83
14 0.8
15 0.78
16 0.75
17 0.75
18 0.72
19 0.68
20 0.66
21 0.57
22 0.52
23 0.47
24 0.45
25 0.45
26 0.5
27 0.51
28 0.5
29 0.58
30 0.63
31 0.68
32 0.73
33 0.71
34 0.71
35 0.75
36 0.75
37 0.77
38 0.78
39 0.77
40 0.73
41 0.75
42 0.73
43 0.73
44 0.72
45 0.72
46 0.74
47 0.75
48 0.75
49 0.72
50 0.73
51 0.71
52 0.73
53 0.73
54 0.74
55 0.75
56 0.79
57 0.83
58 0.86
59 0.88
60 0.91
61 0.92
62 0.91
63 0.92
64 0.92
65 0.91
66 0.88
67 0.88
68 0.87
69 0.86
70 0.81
71 0.77
72 0.74
73 0.69
74 0.62
75 0.56
76 0.49
77 0.46
78 0.44
79 0.41
80 0.37
81 0.38
82 0.46
83 0.51
84 0.52
85 0.48
86 0.45
87 0.48
88 0.48
89 0.46
90 0.43
91 0.38
92 0.39
93 0.38
94 0.38
95 0.3
96 0.28
97 0.24
98 0.19
99 0.16
100 0.13
101 0.11
102 0.12
103 0.12
104 0.12
105 0.11
106 0.12
107 0.12
108 0.11
109 0.11
110 0.1
111 0.1
112 0.11
113 0.13
114 0.12
115 0.11
116 0.12
117 0.12
118 0.12
119 0.14
120 0.16
121 0.13
122 0.15
123 0.16
124 0.22
125 0.23
126 0.25
127 0.28
128 0.28
129 0.3
130 0.29
131 0.31
132 0.26
133 0.26
134 0.24
135 0.19
136 0.18
137 0.17
138 0.16
139 0.12
140 0.1
141 0.1
142 0.09
143 0.11
144 0.11
145 0.11
146 0.12
147 0.13
148 0.14
149 0.14
150 0.15
151 0.17
152 0.19
153 0.22
154 0.23
155 0.29
156 0.3
157 0.38
158 0.39
159 0.38
160 0.45
161 0.49
162 0.54
163 0.51
164 0.56
165 0.52
166 0.56
167 0.53
168 0.43
169 0.38
170 0.32
171 0.28
172 0.2
173 0.16
174 0.11
175 0.12
176 0.11
177 0.1
178 0.09
179 0.09
180 0.1
181 0.1
182 0.12
183 0.13
184 0.13
185 0.14
186 0.14
187 0.15
188 0.17
189 0.19
190 0.17
191 0.15
192 0.17
193 0.2
194 0.21
195 0.2
196 0.17
197 0.15
198 0.21
199 0.2
200 0.2
201 0.21
202 0.21
203 0.23
204 0.29
205 0.29
206 0.23
207 0.26
208 0.24
209 0.24
210 0.31
211 0.32
212 0.3
213 0.38
214 0.44
215 0.43
216 0.48
217 0.52
218 0.54
219 0.55
220 0.55
221 0.52
222 0.45
223 0.47
224 0.42
225 0.38
226 0.34
227 0.31
228 0.28
229 0.25
230 0.25
231 0.21
232 0.2
233 0.16
234 0.11
235 0.1
236 0.1
237 0.07
238 0.06
239 0.07
240 0.07