Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K1R0F2

Protein Details
Accession A0A2K1R0F2    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-32AATKRKSAKAADKGGKRKKDPNAPKRGLBasic
NLS Segment(s)
PositionSequence
7-30TKRKSAKAADKGGKRKKDPNAPKR
Subcellular Location(s) nucl 19, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEAATKRKSAKAADKGGKRKKDPNAPKRGLSAYMFFANEQRDKVREDNPGIKFGEVGKMLGDKWKQLSDKQKAPYEAKAAADKKRYEDQKAAYQAGGVDDEDEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.7
3 0.74
4 0.76
5 0.81
6 0.82
7 0.78
8 0.77
9 0.76
10 0.78
11 0.8
12 0.8
13 0.82
14 0.77
15 0.74
16 0.7
17 0.63
18 0.55
19 0.46
20 0.37
21 0.29
22 0.26
23 0.24
24 0.2
25 0.2
26 0.2
27 0.19
28 0.18
29 0.17
30 0.16
31 0.19
32 0.22
33 0.24
34 0.26
35 0.28
36 0.35
37 0.34
38 0.36
39 0.33
40 0.3
41 0.27
42 0.22
43 0.21
44 0.14
45 0.12
46 0.09
47 0.09
48 0.1
49 0.14
50 0.14
51 0.12
52 0.14
53 0.18
54 0.19
55 0.25
56 0.35
57 0.38
58 0.44
59 0.49
60 0.52
61 0.53
62 0.55
63 0.53
64 0.47
65 0.42
66 0.38
67 0.4
68 0.38
69 0.39
70 0.43
71 0.41
72 0.41
73 0.47
74 0.5
75 0.48
76 0.51
77 0.5
78 0.52
79 0.57
80 0.53
81 0.44
82 0.4
83 0.35
84 0.29
85 0.25
86 0.16
87 0.11
88 0.09