Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K1R2F3

Protein Details
Accession A0A2K1R2F3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-96DVTAKKPKKVKERQKAKAKQTPVHydrophilic
NLS Segment(s)
PositionSequence
77-92AKKPKKVKERQKAKAK
Subcellular Location(s) cyto_nucl 10.833, cyto 10.5, nucl 10, mito_nucl 8.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036573  CBM_sf_5/12  
Gene Ontology GO:0005576  C:extracellular region  
GO:0030246  F:carbohydrate binding  
GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Amino Acid Sequences MVLSSDDPVAHRKKCTVCQTPRDVLIRCQIDDSTTWHMICPGKCWQDVSGGIEDGDGSNPHYRYGGMWKNRHADVTAKKPKKVKERQKAKAKQTPVEWSEVHGKYTKNDAVVFKGQLWVCRKTHEACEDDAPDKAIALWKDDDKSATASDTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.57
3 0.61
4 0.63
5 0.69
6 0.74
7 0.73
8 0.72
9 0.69
10 0.61
11 0.54
12 0.54
13 0.48
14 0.4
15 0.37
16 0.31
17 0.26
18 0.25
19 0.26
20 0.24
21 0.23
22 0.22
23 0.2
24 0.24
25 0.27
26 0.26
27 0.26
28 0.27
29 0.28
30 0.28
31 0.3
32 0.27
33 0.27
34 0.28
35 0.28
36 0.22
37 0.18
38 0.18
39 0.16
40 0.15
41 0.1
42 0.1
43 0.06
44 0.07
45 0.1
46 0.11
47 0.11
48 0.11
49 0.11
50 0.11
51 0.19
52 0.25
53 0.29
54 0.32
55 0.36
56 0.39
57 0.4
58 0.39
59 0.32
60 0.31
61 0.28
62 0.36
63 0.42
64 0.41
65 0.44
66 0.48
67 0.54
68 0.59
69 0.64
70 0.65
71 0.65
72 0.73
73 0.8
74 0.86
75 0.89
76 0.87
77 0.84
78 0.78
79 0.72
80 0.65
81 0.63
82 0.53
83 0.49
84 0.39
85 0.34
86 0.38
87 0.34
88 0.32
89 0.27
90 0.26
91 0.23
92 0.29
93 0.28
94 0.21
95 0.24
96 0.24
97 0.26
98 0.29
99 0.29
100 0.23
101 0.27
102 0.25
103 0.28
104 0.31
105 0.32
106 0.29
107 0.31
108 0.35
109 0.33
110 0.4
111 0.4
112 0.38
113 0.35
114 0.4
115 0.41
116 0.38
117 0.35
118 0.3
119 0.23
120 0.21
121 0.19
122 0.18
123 0.15
124 0.18
125 0.2
126 0.22
127 0.24
128 0.25
129 0.26
130 0.23
131 0.25
132 0.22