Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K1QRT4

Protein Details
Accession A0A2K1QRT4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-70GTEANKNKRWQKLKDCPDGSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 8, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MKVAYILTTALGLIGSGLACEQPGTPCDKRLVGARACQCNAGILLECINLGTEANKNKRWQKLKDCPDGSAIKCANGKCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.04
5 0.03
6 0.04
7 0.04
8 0.05
9 0.06
10 0.07
11 0.14
12 0.15
13 0.17
14 0.2
15 0.2
16 0.21
17 0.25
18 0.3
19 0.25
20 0.31
21 0.34
22 0.36
23 0.36
24 0.35
25 0.3
26 0.24
27 0.22
28 0.16
29 0.11
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.04
38 0.05
39 0.09
40 0.16
41 0.21
42 0.25
43 0.32
44 0.38
45 0.48
46 0.55
47 0.6
48 0.65
49 0.7
50 0.76
51 0.81
52 0.76
53 0.69
54 0.67
55 0.64
56 0.55
57 0.53
58 0.44
59 0.38
60 0.4