Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K1QLY9

Protein Details
Accession A0A2K1QLY9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
180-200REEELKRRRVKEEKKLSGKELBasic
NLS Segment(s)
PositionSequence
173-196KERMEREREEELKRRRVKEEKKLS
Subcellular Location(s) nucl 20.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040213  GIR2-like  
IPR006575  RWD-domain  
IPR016135  UBQ-conjugating_enzyme/RWD  
Pfam View protein in Pfam  
PF05773  RWD  
PROSITE View protein in PROSITE  
PS50908  RWD  
Amino Acid Sequences MGQEDQVEEREVLSSIFPEEITDISPSEYRISIPLDLVPETEDDPPPPTLLLHVSYPEAYPDVAPRLDINAPPNAPRHPQLDIQEDKEQLLQSLDSVIEENLGMAMVFTLVTTLKESAEQLILDRRAEAQTVKDQEIAEAEAEENKKFEGTKVTRETFLKWREGFRKEMEEAKERMEREREEELKRRRVKEEKKLSGKELWVKGLAGNAAEEDDDEELVEGLKEVKVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.09
5 0.09
6 0.09
7 0.09
8 0.1
9 0.11
10 0.1
11 0.12
12 0.13
13 0.13
14 0.14
15 0.14
16 0.13
17 0.15
18 0.17
19 0.16
20 0.16
21 0.16
22 0.16
23 0.16
24 0.16
25 0.14
26 0.12
27 0.13
28 0.15
29 0.14
30 0.13
31 0.15
32 0.16
33 0.15
34 0.14
35 0.13
36 0.12
37 0.13
38 0.14
39 0.12
40 0.13
41 0.14
42 0.14
43 0.14
44 0.13
45 0.12
46 0.1
47 0.09
48 0.1
49 0.12
50 0.11
51 0.12
52 0.11
53 0.13
54 0.15
55 0.16
56 0.16
57 0.18
58 0.19
59 0.2
60 0.23
61 0.22
62 0.23
63 0.24
64 0.24
65 0.23
66 0.27
67 0.29
68 0.34
69 0.34
70 0.36
71 0.37
72 0.34
73 0.32
74 0.29
75 0.25
76 0.18
77 0.16
78 0.11
79 0.07
80 0.08
81 0.07
82 0.05
83 0.06
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.03
98 0.03
99 0.04
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07
108 0.1
109 0.11
110 0.11
111 0.11
112 0.11
113 0.11
114 0.12
115 0.12
116 0.1
117 0.15
118 0.18
119 0.18
120 0.19
121 0.19
122 0.18
123 0.18
124 0.17
125 0.11
126 0.09
127 0.08
128 0.09
129 0.1
130 0.1
131 0.09
132 0.09
133 0.09
134 0.09
135 0.1
136 0.17
137 0.19
138 0.27
139 0.34
140 0.35
141 0.38
142 0.39
143 0.42
144 0.41
145 0.42
146 0.41
147 0.36
148 0.42
149 0.46
150 0.48
151 0.48
152 0.43
153 0.45
154 0.4
155 0.45
156 0.42
157 0.41
158 0.39
159 0.4
160 0.4
161 0.35
162 0.38
163 0.37
164 0.34
165 0.33
166 0.41
167 0.42
168 0.45
169 0.53
170 0.57
171 0.62
172 0.68
173 0.67
174 0.67
175 0.72
176 0.75
177 0.76
178 0.79
179 0.79
180 0.82
181 0.82
182 0.78
183 0.73
184 0.7
185 0.67
186 0.6
187 0.53
188 0.44
189 0.4
190 0.36
191 0.33
192 0.27
193 0.19
194 0.15
195 0.12
196 0.11
197 0.1
198 0.1
199 0.08
200 0.08
201 0.07
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.06
208 0.06