Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K1R181

Protein Details
Accession A0A2K1R181    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
492-511AEKARGRARGKEREKFRGVDBasic
NLS Segment(s)
PositionSequence
494-506KARGRARGKEREK
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR023753  FAD/NAD-binding_dom  
IPR021163  Ferredox_Rdtase_adrenod  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0015039  F:NADPH-adrenodoxin reductase activity  
Pfam View protein in Pfam  
PF07992  Pyr_redox_2  
Amino Acid Sequences MSVRWATTRSPILGQNYSTARSRPPRIGVIGSGPAGFYAARRLQQKVEGVKIDMYEMLPTPYGLVRFGVAPDHPEVKNCIDTFTQVAEHPSFTYIGNISIGTSPSSLPLSTLTANYDAILFAYGASRDKQLGIPGESLDGVHSARAFVGWYNGLPEYAGLKPDFERTDQAVVIGQGNVAMDVARILIAPLSHLRSTDITEEALELLSRSRIRNVKIVGRRGPLQAAYTTKELRELVKLENAHLKPINESVLPADYNDIKKLPRGALKRQIELLLKGSSTSAEIAARHWSLEYLLSPTRFQDNDTATTGRLARIQFQQNEYVPMTKDDVAKAAASAEDLSNLLKAMKVQPSPSSDPVSFEAGLAFRSVGYKSEPLDGLSDVGVPFDEKVGIIPNDLYGRVISPSKGPGELSAGHVPGMYAAGWVKRGPTGVIASTMEDAFISADVIRQDWIEGAKFLQSKDGQALGWEAVQEEAKSRGIRSISWQDWTRIDEAEKARGRARGKEREKFRGVDEMLKVLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.39
4 0.39
5 0.38
6 0.34
7 0.37
8 0.41
9 0.46
10 0.47
11 0.49
12 0.52
13 0.54
14 0.55
15 0.49
16 0.46
17 0.43
18 0.37
19 0.31
20 0.25
21 0.2
22 0.18
23 0.15
24 0.1
25 0.14
26 0.18
27 0.23
28 0.26
29 0.3
30 0.32
31 0.39
32 0.46
33 0.44
34 0.47
35 0.44
36 0.43
37 0.42
38 0.39
39 0.34
40 0.27
41 0.21
42 0.16
43 0.14
44 0.14
45 0.12
46 0.12
47 0.12
48 0.13
49 0.13
50 0.12
51 0.12
52 0.11
53 0.11
54 0.12
55 0.13
56 0.12
57 0.14
58 0.17
59 0.21
60 0.21
61 0.22
62 0.25
63 0.26
64 0.32
65 0.29
66 0.28
67 0.24
68 0.26
69 0.26
70 0.24
71 0.22
72 0.17
73 0.21
74 0.19
75 0.19
76 0.18
77 0.17
78 0.16
79 0.14
80 0.16
81 0.12
82 0.12
83 0.12
84 0.11
85 0.11
86 0.12
87 0.12
88 0.11
89 0.11
90 0.1
91 0.11
92 0.12
93 0.11
94 0.1
95 0.11
96 0.13
97 0.13
98 0.14
99 0.14
100 0.14
101 0.14
102 0.14
103 0.13
104 0.1
105 0.09
106 0.09
107 0.06
108 0.05
109 0.06
110 0.07
111 0.08
112 0.1
113 0.11
114 0.11
115 0.12
116 0.13
117 0.16
118 0.19
119 0.2
120 0.2
121 0.19
122 0.19
123 0.18
124 0.16
125 0.13
126 0.1
127 0.08
128 0.07
129 0.07
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.08
136 0.08
137 0.08
138 0.1
139 0.1
140 0.1
141 0.09
142 0.09
143 0.1
144 0.1
145 0.12
146 0.1
147 0.11
148 0.12
149 0.16
150 0.18
151 0.16
152 0.19
153 0.19
154 0.22
155 0.21
156 0.2
157 0.17
158 0.16
159 0.15
160 0.12
161 0.09
162 0.07
163 0.07
164 0.06
165 0.05
166 0.04
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.04
174 0.04
175 0.05
176 0.07
177 0.1
178 0.1
179 0.11
180 0.12
181 0.13
182 0.15
183 0.15
184 0.14
185 0.11
186 0.11
187 0.11
188 0.1
189 0.09
190 0.07
191 0.05
192 0.05
193 0.07
194 0.09
195 0.1
196 0.15
197 0.19
198 0.21
199 0.27
200 0.3
201 0.36
202 0.41
203 0.47
204 0.46
205 0.45
206 0.45
207 0.41
208 0.39
209 0.31
210 0.26
211 0.22
212 0.19
213 0.19
214 0.19
215 0.18
216 0.17
217 0.18
218 0.17
219 0.16
220 0.17
221 0.16
222 0.15
223 0.19
224 0.19
225 0.18
226 0.26
227 0.24
228 0.25
229 0.24
230 0.23
231 0.2
232 0.21
233 0.21
234 0.12
235 0.13
236 0.11
237 0.1
238 0.1
239 0.09
240 0.09
241 0.1
242 0.11
243 0.11
244 0.12
245 0.11
246 0.12
247 0.14
248 0.16
249 0.2
250 0.24
251 0.3
252 0.39
253 0.42
254 0.42
255 0.41
256 0.41
257 0.36
258 0.32
259 0.28
260 0.19
261 0.16
262 0.15
263 0.13
264 0.1
265 0.09
266 0.08
267 0.06
268 0.07
269 0.07
270 0.08
271 0.11
272 0.1
273 0.1
274 0.09
275 0.09
276 0.08
277 0.09
278 0.09
279 0.09
280 0.11
281 0.12
282 0.12
283 0.13
284 0.16
285 0.16
286 0.16
287 0.19
288 0.19
289 0.21
290 0.24
291 0.24
292 0.2
293 0.22
294 0.21
295 0.16
296 0.17
297 0.14
298 0.15
299 0.21
300 0.27
301 0.28
302 0.3
303 0.34
304 0.31
305 0.34
306 0.31
307 0.27
308 0.21
309 0.2
310 0.2
311 0.18
312 0.19
313 0.15
314 0.16
315 0.15
316 0.14
317 0.13
318 0.11
319 0.08
320 0.07
321 0.08
322 0.06
323 0.06
324 0.06
325 0.06
326 0.06
327 0.06
328 0.06
329 0.05
330 0.07
331 0.1
332 0.16
333 0.17
334 0.19
335 0.22
336 0.28
337 0.33
338 0.35
339 0.35
340 0.3
341 0.32
342 0.32
343 0.31
344 0.25
345 0.2
346 0.18
347 0.14
348 0.14
349 0.11
350 0.09
351 0.06
352 0.07
353 0.08
354 0.08
355 0.1
356 0.12
357 0.13
358 0.17
359 0.17
360 0.17
361 0.18
362 0.17
363 0.15
364 0.13
365 0.12
366 0.09
367 0.08
368 0.08
369 0.06
370 0.06
371 0.06
372 0.06
373 0.05
374 0.05
375 0.1
376 0.1
377 0.11
378 0.11
379 0.12
380 0.13
381 0.13
382 0.13
383 0.09
384 0.1
385 0.11
386 0.13
387 0.11
388 0.12
389 0.16
390 0.17
391 0.18
392 0.17
393 0.16
394 0.19
395 0.19
396 0.22
397 0.22
398 0.2
399 0.19
400 0.19
401 0.18
402 0.14
403 0.13
404 0.08
405 0.06
406 0.07
407 0.08
408 0.1
409 0.1
410 0.11
411 0.12
412 0.12
413 0.12
414 0.14
415 0.16
416 0.15
417 0.18
418 0.18
419 0.17
420 0.18
421 0.17
422 0.14
423 0.11
424 0.1
425 0.08
426 0.07
427 0.06
428 0.05
429 0.07
430 0.08
431 0.08
432 0.09
433 0.08
434 0.09
435 0.1
436 0.12
437 0.11
438 0.11
439 0.11
440 0.16
441 0.18
442 0.18
443 0.24
444 0.23
445 0.24
446 0.27
447 0.28
448 0.22
449 0.21
450 0.23
451 0.16
452 0.16
453 0.14
454 0.11
455 0.11
456 0.12
457 0.11
458 0.11
459 0.13
460 0.17
461 0.18
462 0.18
463 0.22
464 0.23
465 0.24
466 0.3
467 0.37
468 0.36
469 0.42
470 0.45
471 0.43
472 0.45
473 0.46
474 0.4
475 0.32
476 0.32
477 0.32
478 0.32
479 0.39
480 0.4
481 0.4
482 0.42
483 0.46
484 0.48
485 0.5
486 0.56
487 0.58
488 0.63
489 0.69
490 0.74
491 0.78
492 0.8
493 0.73
494 0.67
495 0.66
496 0.59
497 0.57
498 0.51