FuNGI

A0A2K1R181

Protein Details

Accession

A0A2K1R181

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
492-511	AEKARGRARGKEREKFRGVD	Basic

NLS Segment(s)

Position	Sequence
494-506	KARGRARGKEREK

Subcellular Location(s)

mito 27

Family & Domain DBs

InterPro	View protein in InterPro IPR036188 FAD/NAD-bd_sf IPR023753 FAD/NAD-binding_dom IPR021163 Ferredox_Rdtase_adrenod
Gene Ontology	GO:0005739 C:mitochondrion GO:0015039 F:NADPH-adrenodoxin reductase activity
Pfam	View protein in Pfam PF07992 Pyr_redox_2

Amino Acid Sequences

MSVRWATTRSPILGQNYSTARSRPPRIGVIGSGPAGFYAARRLQQKVEGVKIDMYEMLPTPYGLVRFGVAPDHPEVKNCIDTFTQVAEHPSFTYIGNISIGTSPSSLPLSTLTANYDAILFAYGASRDKQLGIPGESLDGVHSARAFVGWYNGLPEYAGLKPDFERTDQAVVIGQGNVAMDVARILIAPLSHLRSTDITEEALELLSRSRIRNVKIVGRRGPLQAAYTTKELRELVKLENAHLKPINESVLPADYNDIKKLPRGALKRQIELLLKGSSTSAEIAARHWSLEYLLSPTRFQDNDTATTGRLARIQFQQNEYVPMTKDDVAKAAASAEDLSNLLKAMKVQPSPSSDPVSFEAGLAFRSVGYKSEPLDGLSDVGVPFDEKVGIIPNDLYGRVISPSKGPGELSAGHVPGMYAAGWVKRGPTGVIASTMEDAFISADVIRQDWIEGAKFLQSKDGQALGWEAVQEEAKSRGIRSISWQDWTRIDEAEKARGRARGKEREKFRGVDEMLKVLD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.41
2	0.41
3	0.39
4	0.39
5	0.38
6	0.34
7	0.37
8	0.41
9	0.46
10	0.47
11	0.49
12	0.52
13	0.54
14	0.55
15	0.49
16	0.46
17	0.43
18	0.37
19	0.31
20	0.25
21	0.2
22	0.18
23	0.15
24	0.1
25	0.14
26	0.18
27	0.23
28	0.26
29	0.3
30	0.32
31	0.39
32	0.46
33	0.44
34	0.47
35	0.44
36	0.43
37	0.42
38	0.39
39	0.34
40	0.27
41	0.21
42	0.16
43	0.14
44	0.14
45	0.12
46	0.12
47	0.12
48	0.13
49	0.13
50	0.12
51	0.12
52	0.11
53	0.11
54	0.12
55	0.13
56	0.12
57	0.14
58	0.17
59	0.21
60	0.21
61	0.22
62	0.25
63	0.26
64	0.32
65	0.29
66	0.28
67	0.24
68	0.26
69	0.26
70	0.24
71	0.22
72	0.17
73	0.21
74	0.19
75	0.19
76	0.18
77	0.17
78	0.16
79	0.14
80	0.16
81	0.12
82	0.12
83	0.12
84	0.11
85	0.11
86	0.12
87	0.12
88	0.11
89	0.11
90	0.1
91	0.11
92	0.12
93	0.11
94	0.1
95	0.11
96	0.13
97	0.13
98	0.14
99	0.14
100	0.14
101	0.14
102	0.14
103	0.13
104	0.1
105	0.09
106	0.09
107	0.06
108	0.05
109	0.06
110	0.07
111	0.08
112	0.1
113	0.11
114	0.11
115	0.12
116	0.13
117	0.16
118	0.19
119	0.2
120	0.2
121	0.19
122	0.19
123	0.18
124	0.16
125	0.13
126	0.1
127	0.08
128	0.07
129	0.07
130	0.06
131	0.06
132	0.06
133	0.06
134	0.06
135	0.08
136	0.08
137	0.08
138	0.1
139	0.1
140	0.1
141	0.09
142	0.09
143	0.1
144	0.1
145	0.12
146	0.1
147	0.11
148	0.12
149	0.16
150	0.18
151	0.16
152	0.19
153	0.19
154	0.22
155	0.21
156	0.2
157	0.17
158	0.16
159	0.15
160	0.12
161	0.09
162	0.07
163	0.07
164	0.06
165	0.05
166	0.04
167	0.03
168	0.03
169	0.03
170	0.03
171	0.03
172	0.03
173	0.04
174	0.04
175	0.05
176	0.07
177	0.1
178	0.1
179	0.11
180	0.12
181	0.13
182	0.15
183	0.15
184	0.14
185	0.11
186	0.11
187	0.11
188	0.1
189	0.09
190	0.07
191	0.05
192	0.05
193	0.07
194	0.09
195	0.1
196	0.15
197	0.19
198	0.21
199	0.27
200	0.3
201	0.36
202	0.41
203	0.47
204	0.46
205	0.45
206	0.45
207	0.41
208	0.39
209	0.31
210	0.26
211	0.22
212	0.19
213	0.19
214	0.19
215	0.18
216	0.17
217	0.18
218	0.17
219	0.16
220	0.17
221	0.16
222	0.15
223	0.19
224	0.19
225	0.18
226	0.26
227	0.24
228	0.25
229	0.24
230	0.23
231	0.2
232	0.21
233	0.21
234	0.12
235	0.13
236	0.11
237	0.1
238	0.1
239	0.09
240	0.09
241	0.1
242	0.11
243	0.11
244	0.12
245	0.11
246	0.12
247	0.14
248	0.16
249	0.2
250	0.24
251	0.3
252	0.39
253	0.42
254	0.42
255	0.41
256	0.41
257	0.36
258	0.32
259	0.28
260	0.19
261	0.16
262	0.15
263	0.13
264	0.1
265	0.09
266	0.08
267	0.06
268	0.07
269	0.07
270	0.08
271	0.11
272	0.1
273	0.1
274	0.09
275	0.09
276	0.08
277	0.09
278	0.09
279	0.09
280	0.11
281	0.12
282	0.12
283	0.13
284	0.16
285	0.16
286	0.16
287	0.19
288	0.19
289	0.21
290	0.24
291	0.24
292	0.2
293	0.22
294	0.21
295	0.16
296	0.17
297	0.14
298	0.15
299	0.21
300	0.27
301	0.28
302	0.3
303	0.34
304	0.31
305	0.34
306	0.31
307	0.27
308	0.21
309	0.2
310	0.2
311	0.18
312	0.19
313	0.15
314	0.16
315	0.15
316	0.14
317	0.13
318	0.11
319	0.08
320	0.07
321	0.08
322	0.06
323	0.06
324	0.06
325	0.06
326	0.06
327	0.06
328	0.06
329	0.05
330	0.07
331	0.1
332	0.16
333	0.17
334	0.19
335	0.22
336	0.28
337	0.33
338	0.35
339	0.35
340	0.3
341	0.32
342	0.32
343	0.31
344	0.25
345	0.2
346	0.18
347	0.14
348	0.14
349	0.11
350	0.09
351	0.06
352	0.07
353	0.08
354	0.08
355	0.1
356	0.12
357	0.13
358	0.17
359	0.17
360	0.17
361	0.18
362	0.17
363	0.15
364	0.13
365	0.12
366	0.09
367	0.08
368	0.08
369	0.06
370	0.06
371	0.06
372	0.06
373	0.05
374	0.05
375	0.1
376	0.1
377	0.11
378	0.11
379	0.12
380	0.13
381	0.13
382	0.13
383	0.09
384	0.1
385	0.11
386	0.13
387	0.11
388	0.12
389	0.16
390	0.17
391	0.18
392	0.17
393	0.16
394	0.19
395	0.19
396	0.22
397	0.22
398	0.2
399	0.19
400	0.19
401	0.18
402	0.14
403	0.13
404	0.08
405	0.06
406	0.07
407	0.08
408	0.1
409	0.1
410	0.11
411	0.12
412	0.12
413	0.12
414	0.14
415	0.16
416	0.15
417	0.18
418	0.18
419	0.17
420	0.18
421	0.17
422	0.14
423	0.11
424	0.1
425	0.08
426	0.07
427	0.06
428	0.05
429	0.07
430	0.08
431	0.08
432	0.09
433	0.08
434	0.09
435	0.1
436	0.12
437	0.11
438	0.11
439	0.11
440	0.16
441	0.18
442	0.18
443	0.24
444	0.23
445	0.24
446	0.27
447	0.28
448	0.22
449	0.21
450	0.23
451	0.16
452	0.16
453	0.14
454	0.11
455	0.11
456	0.12
457	0.11
458	0.11
459	0.13
460	0.17
461	0.18
462	0.18
463	0.22
464	0.23
465	0.24
466	0.3
467	0.37
468	0.36
469	0.42
470	0.45
471	0.43
472	0.45
473	0.46
474	0.4
475	0.32
476	0.32
477	0.32
478	0.32
479	0.39
480	0.4
481	0.4
482	0.42
483	0.46
484	0.48
485	0.5
486	0.56
487	0.58
488	0.63
489	0.69
490	0.74
491	0.78
492	0.8
493	0.73
494	0.67
495	0.66
496	0.59
497	0.57
498	0.51

A0A2K1R181

3D AlphaFold-predicted Structure Viewer