Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LYR2

Protein Details
Accession E2LYR2    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
140-170KAAVKKPAKKVAVKKPRKSVNSRPKKLEYANHydrophilic
NLS Segment(s)
PositionSequence
96-165PSAKAPVKAPVKAPAKAPPKAPARKLATTEKTAAVKKPVAKKPAKAAVKKPAKKVAVKKPRKSVNSRPKK
Subcellular Location(s) mito 13.5, mito_nucl 12.5, nucl 10.5
Family & Domain DBs
KEGG mpr:MPER_12460  -  
Amino Acid Sequences MSSAARLLSLPHGRNELTQLADRARTQSTNLPDASVPQPAGGVQIIDETQSTIARCTRDVDEEEEKGFWRRAMDLVVRQVTGQKKIQGKAAACTKPSAKAPVKAPVKAPAKAPPKAPARKLATTEKTAAVKKPVAKKPAKAAVKKPAKKVAVKKPRKSVNSRPKKLEYANISIFEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.3
4 0.26
5 0.27
6 0.27
7 0.26
8 0.28
9 0.28
10 0.27
11 0.26
12 0.24
13 0.24
14 0.28
15 0.3
16 0.32
17 0.31
18 0.3
19 0.27
20 0.3
21 0.29
22 0.24
23 0.2
24 0.14
25 0.14
26 0.13
27 0.14
28 0.1
29 0.09
30 0.06
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.08
38 0.08
39 0.09
40 0.11
41 0.12
42 0.13
43 0.15
44 0.16
45 0.18
46 0.2
47 0.24
48 0.25
49 0.26
50 0.26
51 0.23
52 0.22
53 0.21
54 0.2
55 0.15
56 0.12
57 0.11
58 0.11
59 0.14
60 0.16
61 0.16
62 0.2
63 0.2
64 0.2
65 0.19
66 0.22
67 0.21
68 0.23
69 0.22
70 0.23
71 0.26
72 0.27
73 0.31
74 0.31
75 0.29
76 0.3
77 0.36
78 0.33
79 0.29
80 0.3
81 0.26
82 0.25
83 0.26
84 0.29
85 0.24
86 0.27
87 0.29
88 0.37
89 0.39
90 0.38
91 0.38
92 0.39
93 0.41
94 0.38
95 0.37
96 0.37
97 0.4
98 0.41
99 0.41
100 0.4
101 0.45
102 0.5
103 0.51
104 0.51
105 0.51
106 0.53
107 0.56
108 0.57
109 0.52
110 0.49
111 0.49
112 0.43
113 0.41
114 0.4
115 0.37
116 0.33
117 0.33
118 0.35
119 0.43
120 0.46
121 0.51
122 0.54
123 0.56
124 0.61
125 0.66
126 0.68
127 0.65
128 0.66
129 0.67
130 0.73
131 0.75
132 0.73
133 0.72
134 0.7
135 0.72
136 0.75
137 0.75
138 0.75
139 0.8
140 0.81
141 0.82
142 0.86
143 0.86
144 0.85
145 0.85
146 0.85
147 0.86
148 0.85
149 0.84
150 0.81
151 0.8
152 0.75
153 0.73
154 0.69
155 0.66
156 0.63