Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K1QN78

Protein Details
Accession A0A2K1QN78    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
157-179AATGRPRRPRPGRPTRRPRPTGVBasic
284-305GTGSGRPRAGRPGRKPRPTGTSBasic
NLS Segment(s)
PositionSequence
116-129RPGRGRRPRPSRGG
159-176TGRPRRPRPGRPTRRPRP
204-221ARPTGRPGRPGRPGRGPR
272-301RPGHHGRRPRPTGTGSGRPRAGRPGRKPRP
Subcellular Location(s) extr 9, mito 8, nucl 6, cyto 1, plas 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MKFLTFATLSLATLAFAVPDAQDEEFAPAPTGFPSFGAGSEAPDLDKLRSLLDSFRSRGGATGGAPFPRPTARPTRSRPGRPAPTGGLFPGLGERSLELAEGEAEDFFGAAFPTGRPGRGRRPRPSRGGGGVAPTGLFPGFPRPTGEGSEPEAGAAAATGRPRRPRPGRPTRRPRPTGVSDATDLDKRAFDEADESEERVPGAARPTGRPGRPGRPGRGPRPTGVFPGFPGFPRPTGGMPSFPLPTGGFFDGEGEESVGGAAFDGAAAPTGRPGHHGRRPRPTGTGSGRPRAGRPGRKPRPTGTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.06
3 0.06
4 0.06
5 0.05
6 0.07
7 0.09
8 0.08
9 0.1
10 0.1
11 0.14
12 0.14
13 0.15
14 0.15
15 0.13
16 0.14
17 0.14
18 0.14
19 0.11
20 0.1
21 0.12
22 0.11
23 0.11
24 0.14
25 0.14
26 0.14
27 0.15
28 0.15
29 0.13
30 0.15
31 0.16
32 0.13
33 0.16
34 0.14
35 0.14
36 0.15
37 0.16
38 0.17
39 0.24
40 0.28
41 0.27
42 0.3
43 0.3
44 0.28
45 0.28
46 0.26
47 0.2
48 0.16
49 0.2
50 0.19
51 0.19
52 0.2
53 0.19
54 0.2
55 0.21
56 0.21
57 0.2
58 0.29
59 0.34
60 0.42
61 0.48
62 0.58
63 0.64
64 0.7
65 0.74
66 0.74
67 0.77
68 0.71
69 0.69
70 0.62
71 0.55
72 0.48
73 0.4
74 0.32
75 0.22
76 0.19
77 0.17
78 0.13
79 0.1
80 0.09
81 0.09
82 0.08
83 0.09
84 0.09
85 0.06
86 0.06
87 0.05
88 0.06
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.09
101 0.1
102 0.11
103 0.14
104 0.19
105 0.29
106 0.39
107 0.48
108 0.53
109 0.62
110 0.68
111 0.72
112 0.73
113 0.67
114 0.6
115 0.55
116 0.46
117 0.38
118 0.31
119 0.24
120 0.19
121 0.14
122 0.11
123 0.07
124 0.06
125 0.04
126 0.1
127 0.11
128 0.11
129 0.13
130 0.15
131 0.17
132 0.19
133 0.2
134 0.16
135 0.18
136 0.19
137 0.17
138 0.15
139 0.13
140 0.11
141 0.09
142 0.07
143 0.04
144 0.04
145 0.06
146 0.08
147 0.11
148 0.16
149 0.19
150 0.28
151 0.36
152 0.45
153 0.54
154 0.63
155 0.72
156 0.78
157 0.87
158 0.88
159 0.9
160 0.85
161 0.79
162 0.75
163 0.69
164 0.65
165 0.56
166 0.48
167 0.39
168 0.37
169 0.34
170 0.27
171 0.22
172 0.16
173 0.14
174 0.12
175 0.12
176 0.1
177 0.09
178 0.1
179 0.1
180 0.15
181 0.15
182 0.15
183 0.14
184 0.14
185 0.14
186 0.12
187 0.11
188 0.08
189 0.1
190 0.12
191 0.13
192 0.14
193 0.22
194 0.29
195 0.29
196 0.35
197 0.38
198 0.43
199 0.52
200 0.57
201 0.55
202 0.59
203 0.66
204 0.67
205 0.71
206 0.66
207 0.59
208 0.6
209 0.55
210 0.5
211 0.45
212 0.37
213 0.29
214 0.3
215 0.28
216 0.22
217 0.25
218 0.21
219 0.19
220 0.21
221 0.21
222 0.19
223 0.23
224 0.24
225 0.22
226 0.22
227 0.24
228 0.23
229 0.2
230 0.21
231 0.16
232 0.16
233 0.18
234 0.17
235 0.15
236 0.14
237 0.15
238 0.14
239 0.14
240 0.13
241 0.09
242 0.08
243 0.07
244 0.07
245 0.06
246 0.05
247 0.04
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.04
254 0.05
255 0.05
256 0.09
257 0.11
258 0.11
259 0.16
260 0.23
261 0.31
262 0.39
263 0.49
264 0.55
265 0.64
266 0.71
267 0.7
268 0.7
269 0.64
270 0.65
271 0.63
272 0.65
273 0.61
274 0.62
275 0.64
276 0.6
277 0.58
278 0.59
279 0.61
280 0.61
281 0.65
282 0.69
283 0.74
284 0.82
285 0.85