Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K1QUB9

Protein Details
Accession A0A2K1QUB9    Localization Confidence High Confidence Score 21
NoLS Segment(s)
PositionSequenceProtein Nature
69-90HTRSEPKAKKDKTPKIPKSSIPBasic
140-159LYAKSAKQRRKAAKALRKKEHydrophilic
203-229AVRQDVTKALRKKRRAKIKEMNFLKGMHydrophilic
NLS Segment(s)
PositionSequence
74-86PKAKKDKTPKIPK
144-158SAKQRRKAAKALRKK
211-221ALRKKRRAKIK
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MICQRCIRTGFRNTFSQTRSISRTSILSSTPKSPNAATQASPRPAPPGAPHSPSAATSTSAAQSFGTPHTRSEPKAKKDKTPKIPKSSIPAGMPLKGLNLLKGKTDPLAMEDKEYPPWLWTLLVDSKREGAEVAQGEGDLYAKSAKQRRKAAKALRKKEMAMAASGKSLAPAVPLEEQSIDLPAGDSLGASPRAVEVNLQASAVRQDVTKALRKKRRAKIKEMNFLKGMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.56
4 0.49
5 0.47
6 0.47
7 0.43
8 0.39
9 0.34
10 0.34
11 0.31
12 0.3
13 0.27
14 0.28
15 0.28
16 0.34
17 0.37
18 0.36
19 0.36
20 0.34
21 0.36
22 0.37
23 0.37
24 0.32
25 0.35
26 0.41
27 0.41
28 0.41
29 0.36
30 0.34
31 0.32
32 0.32
33 0.28
34 0.28
35 0.3
36 0.33
37 0.33
38 0.32
39 0.32
40 0.31
41 0.3
42 0.23
43 0.19
44 0.16
45 0.17
46 0.15
47 0.15
48 0.14
49 0.12
50 0.11
51 0.11
52 0.14
53 0.18
54 0.17
55 0.17
56 0.23
57 0.26
58 0.28
59 0.37
60 0.43
61 0.46
62 0.56
63 0.58
64 0.61
65 0.69
66 0.77
67 0.77
68 0.79
69 0.8
70 0.79
71 0.81
72 0.74
73 0.7
74 0.65
75 0.58
76 0.47
77 0.44
78 0.36
79 0.32
80 0.3
81 0.23
82 0.18
83 0.17
84 0.16
85 0.13
86 0.15
87 0.14
88 0.15
89 0.15
90 0.16
91 0.13
92 0.14
93 0.11
94 0.1
95 0.14
96 0.13
97 0.15
98 0.16
99 0.16
100 0.16
101 0.17
102 0.14
103 0.1
104 0.11
105 0.09
106 0.08
107 0.07
108 0.09
109 0.14
110 0.16
111 0.17
112 0.17
113 0.18
114 0.17
115 0.18
116 0.14
117 0.09
118 0.11
119 0.11
120 0.11
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.04
127 0.04
128 0.04
129 0.05
130 0.11
131 0.18
132 0.23
133 0.31
134 0.41
135 0.49
136 0.57
137 0.66
138 0.71
139 0.75
140 0.8
141 0.8
142 0.78
143 0.73
144 0.65
145 0.6
146 0.55
147 0.45
148 0.37
149 0.32
150 0.25
151 0.22
152 0.22
153 0.17
154 0.12
155 0.11
156 0.08
157 0.07
158 0.06
159 0.08
160 0.1
161 0.11
162 0.11
163 0.12
164 0.13
165 0.12
166 0.13
167 0.1
168 0.08
169 0.08
170 0.07
171 0.07
172 0.05
173 0.05
174 0.04
175 0.08
176 0.09
177 0.08
178 0.08
179 0.09
180 0.1
181 0.11
182 0.11
183 0.1
184 0.13
185 0.14
186 0.14
187 0.13
188 0.13
189 0.14
190 0.15
191 0.13
192 0.09
193 0.1
194 0.15
195 0.2
196 0.28
197 0.35
198 0.45
199 0.54
200 0.64
201 0.73
202 0.79
203 0.85
204 0.84
205 0.87
206 0.87
207 0.89
208 0.89
209 0.85
210 0.81