Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K1QL87

Protein Details
Accession A0A2K1QL87    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-66QDSWLARQEKKKKKRTVICWLFWHydrophilic
NLS Segment(s)
PositionSequence
53-58KKKKKR
Subcellular Location(s) plas 19, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MATVRDPAFWKRFSTAVHLNDVESTAGSAASTPSLSKRPTLDHQDSWLARQEKKKKKRTVICWLFWIGILVFGAIVTGVVIYLINSGTMKKLKDTISGEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.36
4 0.4
5 0.37
6 0.35
7 0.32
8 0.31
9 0.23
10 0.15
11 0.12
12 0.07
13 0.06
14 0.05
15 0.05
16 0.04
17 0.05
18 0.05
19 0.05
20 0.08
21 0.12
22 0.13
23 0.15
24 0.16
25 0.21
26 0.26
27 0.34
28 0.37
29 0.34
30 0.36
31 0.41
32 0.39
33 0.35
34 0.37
35 0.3
36 0.28
37 0.35
38 0.43
39 0.48
40 0.58
41 0.66
42 0.68
43 0.76
44 0.82
45 0.83
46 0.84
47 0.82
48 0.74
49 0.68
50 0.61
51 0.51
52 0.42
53 0.34
54 0.22
55 0.14
56 0.11
57 0.07
58 0.05
59 0.05
60 0.05
61 0.03
62 0.03
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.03
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.1
75 0.14
76 0.15
77 0.17
78 0.23
79 0.24
80 0.32