Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LN25

Protein Details
Accession E2LN25    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-35ILLDTKKQRKQVKQMFLERAFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 11.333, cyto 7, cyto_nucl 5.333, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024435  HisRS-related_dom  
KEGG mpr:MPER_08208  -  
Pfam View protein in Pfam  
PF12745  HGTP_anticodon2  
Amino Acid Sequences SLXRHPTCPQHVDXQSILLXDTKKQRKQVKQMFLERAFLRQSAGSGAGIPVIALDVSPSLFELLTRNANWVTEEDSFKALQGEFPSSGYAQQVREAVARKKEDGHSWIMFFAVREERVWVLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.29
4 0.25
5 0.3
6 0.36
7 0.41
8 0.45
9 0.52
10 0.59
11 0.7
12 0.75
13 0.78
14 0.78
15 0.81
16 0.81
17 0.74
18 0.71
19 0.6
20 0.53
21 0.44
22 0.35
23 0.27
24 0.18
25 0.17
26 0.12
27 0.13
28 0.1
29 0.08
30 0.08
31 0.07
32 0.07
33 0.06
34 0.04
35 0.03
36 0.03
37 0.02
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.05
47 0.07
48 0.09
49 0.09
50 0.1
51 0.1
52 0.11
53 0.11
54 0.11
55 0.12
56 0.12
57 0.14
58 0.13
59 0.15
60 0.14
61 0.14
62 0.14
63 0.11
64 0.1
65 0.11
66 0.13
67 0.12
68 0.12
69 0.13
70 0.12
71 0.13
72 0.13
73 0.14
74 0.12
75 0.14
76 0.14
77 0.14
78 0.17
79 0.22
80 0.26
81 0.31
82 0.33
83 0.32
84 0.37
85 0.39
86 0.41
87 0.4
88 0.41
89 0.36
90 0.34
91 0.33
92 0.28
93 0.25
94 0.2
95 0.2
96 0.18
97 0.17
98 0.17
99 0.19
100 0.21