Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P8AJ72

Protein Details
Accession A0A2P8AJ72    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-57PTTPAAPAKKRSRPTPKKVVKPATNYHDHydrophilic
NLS Segment(s)
PositionSequence
37-47AKKRSRPTPKK
Subcellular Location(s) cyto_nucl 13.333, cyto 13, nucl 9.5, mito_nucl 7.832
Family & Domain DBs
Amino Acid Sequences MPRKRTAEEAAVTPSADSGYGSPPQGDAAPTTPAAPAKKRSRPTPKKVVKPATNYHDMPTDLGDAAPLTVSSQTGNDFAAMNSNTGEFEMVVKFHGPKSFQYITTTSYEDGGTLHFIVKPAKAFPLLKLPENVLDKVLKMVLEPEGIKGAKIMINTTTKGIKSKNFAEGLAHRVGIMSVNKQLYENCVPMIYSEHIKFDDAKTVANFMLKYPDVTKNHLRFVEITSYKKDTGPMALSALAQCRKLGRVHLSTNVAMNATPSKAAKGFYSDNSHYFQTVATKMDAVESMNLPERPFDKFRGIDVLRFGTSAKCFSVKEGEDTRAWTKEEKIEFGRILREQIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.18
3 0.15
4 0.12
5 0.09
6 0.11
7 0.14
8 0.15
9 0.15
10 0.15
11 0.16
12 0.17
13 0.16
14 0.15
15 0.14
16 0.16
17 0.16
18 0.16
19 0.17
20 0.2
21 0.24
22 0.27
23 0.35
24 0.42
25 0.51
26 0.57
27 0.66
28 0.73
29 0.79
30 0.83
31 0.85
32 0.85
33 0.87
34 0.9
35 0.9
36 0.87
37 0.84
38 0.84
39 0.79
40 0.77
41 0.67
42 0.59
43 0.53
44 0.45
45 0.37
46 0.3
47 0.24
48 0.17
49 0.16
50 0.14
51 0.09
52 0.09
53 0.08
54 0.06
55 0.05
56 0.05
57 0.06
58 0.06
59 0.07
60 0.08
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.14
67 0.14
68 0.13
69 0.12
70 0.12
71 0.12
72 0.11
73 0.12
74 0.06
75 0.07
76 0.07
77 0.07
78 0.08
79 0.09
80 0.1
81 0.12
82 0.15
83 0.15
84 0.16
85 0.24
86 0.26
87 0.26
88 0.29
89 0.28
90 0.28
91 0.29
92 0.29
93 0.21
94 0.19
95 0.18
96 0.14
97 0.13
98 0.1
99 0.09
100 0.08
101 0.08
102 0.08
103 0.09
104 0.1
105 0.11
106 0.12
107 0.12
108 0.13
109 0.16
110 0.16
111 0.16
112 0.25
113 0.25
114 0.26
115 0.26
116 0.25
117 0.27
118 0.29
119 0.28
120 0.2
121 0.18
122 0.16
123 0.16
124 0.16
125 0.1
126 0.08
127 0.08
128 0.08
129 0.09
130 0.09
131 0.09
132 0.11
133 0.11
134 0.11
135 0.1
136 0.1
137 0.1
138 0.1
139 0.1
140 0.1
141 0.12
142 0.13
143 0.15
144 0.16
145 0.15
146 0.17
147 0.19
148 0.19
149 0.21
150 0.23
151 0.27
152 0.26
153 0.25
154 0.25
155 0.25
156 0.26
157 0.22
158 0.19
159 0.14
160 0.13
161 0.12
162 0.12
163 0.11
164 0.08
165 0.11
166 0.11
167 0.12
168 0.12
169 0.12
170 0.15
171 0.17
172 0.16
173 0.13
174 0.13
175 0.13
176 0.12
177 0.15
178 0.11
179 0.12
180 0.12
181 0.13
182 0.14
183 0.14
184 0.15
185 0.13
186 0.19
187 0.16
188 0.16
189 0.15
190 0.17
191 0.16
192 0.17
193 0.17
194 0.1
195 0.14
196 0.13
197 0.14
198 0.16
199 0.23
200 0.24
201 0.29
202 0.38
203 0.37
204 0.42
205 0.41
206 0.39
207 0.32
208 0.33
209 0.37
210 0.31
211 0.3
212 0.29
213 0.32
214 0.32
215 0.31
216 0.3
217 0.21
218 0.22
219 0.21
220 0.18
221 0.16
222 0.16
223 0.16
224 0.15
225 0.19
226 0.17
227 0.15
228 0.15
229 0.15
230 0.17
231 0.18
232 0.23
233 0.25
234 0.29
235 0.32
236 0.37
237 0.39
238 0.37
239 0.37
240 0.32
241 0.25
242 0.19
243 0.18
244 0.14
245 0.11
246 0.12
247 0.11
248 0.12
249 0.13
250 0.15
251 0.14
252 0.18
253 0.21
254 0.24
255 0.31
256 0.32
257 0.33
258 0.35
259 0.35
260 0.3
261 0.27
262 0.23
263 0.19
264 0.19
265 0.19
266 0.16
267 0.16
268 0.16
269 0.17
270 0.16
271 0.13
272 0.13
273 0.12
274 0.14
275 0.18
276 0.19
277 0.18
278 0.2
279 0.21
280 0.24
281 0.27
282 0.29
283 0.31
284 0.31
285 0.33
286 0.4
287 0.41
288 0.37
289 0.38
290 0.38
291 0.31
292 0.3
293 0.29
294 0.23
295 0.24
296 0.23
297 0.21
298 0.21
299 0.21
300 0.24
301 0.32
302 0.29
303 0.34
304 0.37
305 0.38
306 0.36
307 0.41
308 0.42
309 0.37
310 0.37
311 0.33
312 0.33
313 0.37
314 0.4
315 0.41
316 0.41
317 0.43
318 0.44
319 0.44
320 0.46
321 0.39