Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YIZ2

Protein Details
Accession A0A2P7YIZ2    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-25GTKRSPSPWPFPQRAKKVRFFEHydrophilic
66-112FARGKKGARPRSRSRTPPRSQHESDDEREKRRSRRSQQSEREEKSDRBasic
NLS Segment(s)
PositionSequence
67-116ARGKKGARPRSRSRTPPRSQHESDDEREKRRSRRSQQSEREEKSDRESRK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MAAGTKRSPSPWPFPQRAKKVRFFEDLQPSQIRLTVVFGPKSDPKLTIRIKIGIDEDHKPTVKVDFARGKKGARPRSRSRTPPRSQHESDDEREKRRSRRSQQSEREEKSDRESRKQRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.75
3 0.79
4 0.82
5 0.82
6 0.81
7 0.79
8 0.77
9 0.72
10 0.66
11 0.64
12 0.65
13 0.59
14 0.54
15 0.49
16 0.44
17 0.38
18 0.36
19 0.27
20 0.17
21 0.17
22 0.18
23 0.2
24 0.2
25 0.2
26 0.21
27 0.24
28 0.27
29 0.25
30 0.23
31 0.21
32 0.29
33 0.32
34 0.33
35 0.33
36 0.33
37 0.32
38 0.31
39 0.3
40 0.24
41 0.25
42 0.22
43 0.22
44 0.21
45 0.21
46 0.19
47 0.18
48 0.16
49 0.16
50 0.15
51 0.18
52 0.24
53 0.25
54 0.31
55 0.33
56 0.33
57 0.35
58 0.44
59 0.48
60 0.48
61 0.55
62 0.59
63 0.67
64 0.74
65 0.79
66 0.81
67 0.82
68 0.8
69 0.82
70 0.8
71 0.79
72 0.74
73 0.7
74 0.68
75 0.62
76 0.59
77 0.59
78 0.57
79 0.53
80 0.58
81 0.58
82 0.58
83 0.64
84 0.7
85 0.7
86 0.76
87 0.82
88 0.85
89 0.89
90 0.91
91 0.91
92 0.86
93 0.82
94 0.76
95 0.68
96 0.65
97 0.63
98 0.58
99 0.58