Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YIW9

Protein Details
Accession A0A2P7YIW9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
89-108YLKYLTKKFLKKQQLRDWLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 8, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MVAAVKAGARPAAQKLGKSKGTKQTKKYIINASQPTNDKIFDPSAFATFLQSRIKVDGRTGNLGDNITVTDLKDGKIEVVSHLEFSGRYLKYLTKKFLKKQQLRDWLRVVSTSKGVYELRFYNVVGEGDEEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.42
4 0.48
5 0.5
6 0.54
7 0.55
8 0.65
9 0.69
10 0.69
11 0.72
12 0.74
13 0.76
14 0.75
15 0.74
16 0.7
17 0.71
18 0.7
19 0.63
20 0.6
21 0.55
22 0.51
23 0.43
24 0.36
25 0.28
26 0.25
27 0.24
28 0.18
29 0.18
30 0.16
31 0.15
32 0.15
33 0.15
34 0.15
35 0.13
36 0.15
37 0.15
38 0.15
39 0.15
40 0.17
41 0.19
42 0.17
43 0.18
44 0.21
45 0.21
46 0.23
47 0.23
48 0.2
49 0.2
50 0.19
51 0.17
52 0.11
53 0.09
54 0.07
55 0.07
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.11
67 0.11
68 0.11
69 0.11
70 0.11
71 0.09
72 0.1
73 0.17
74 0.13
75 0.14
76 0.15
77 0.2
78 0.27
79 0.32
80 0.37
81 0.4
82 0.47
83 0.53
84 0.62
85 0.69
86 0.7
87 0.75
88 0.79
89 0.8
90 0.79
91 0.78
92 0.72
93 0.64
94 0.56
95 0.49
96 0.42
97 0.34
98 0.31
99 0.26
100 0.22
101 0.23
102 0.23
103 0.2
104 0.23
105 0.22
106 0.22
107 0.23
108 0.23
109 0.21
110 0.23
111 0.22
112 0.18
113 0.17
114 0.14